GRIP1 Recombinant Protein Antigen

Images

 
There are currently no images for GRIP1 Protein (NBP1-86252PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GRIP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GRIP1.

Source: E. coli

Amino Acid Sequence: DSWDGSAIDTSYGTEGTSFQASGYNFNTYDWRSPKQRGSLSPVTKPRSQTYPDVGLSYEDWDRSTAS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GRIP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86252.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GRIP1 Recombinant Protein Antigen

  • glutamate receptor interacting protein 1
  • glutamate receptor-interacting protein 1
  • GRIP
  • GRIP-1

Background

Steroid and thyroid hormones and retinoic acid regulate a complex array of gene expression activity via intracellular receptor transcription factors belonging to the ligand-dependent nuclear receptor superfamily. Adding to the complexity of function of these transcription factors are associated proteins known as coactivators and corepressors which, as their names suggest, enhance or depress transcription activity of the nuclear receptor with which they associate. Glucocorticoid receptor interacting protein-1 (GRIP 1), or Transcription Intermediary Factor 2 (TIF 2), is a member of a family of transcriptional coactivator proteins which includes steroid receptor coactivator-1 (SRC 1) and Amplified in breast cancer-1 (AIB 1).GRIP1 has been shown to interact and stimulate transcriptional activity of the retinoic acid, retinoid X, vitamin D, mineralocorticoid, glucocorticoid, thyroid hormone, androgen, estrogen, progesterone, and peroxisome proliferator activated receptors. GRIP 1 also contains several copies of the conserved LXXLL/LLXXL motif which has been demonstrated to be critical to receptor-coactivator interactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6257
Species: Hu, Mu, Rt
Applications: WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
NBP1-89953
Species: Hu
Applications: IHC,  IHC-P
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-56929
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
NBP2-75510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-90256
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-86856
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NLS892
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC,  IHC-P, WB
NB100-41403
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB200-310
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
291-G1
Species: Hu
Applications: BA
NBP1-86252PEP
Species: Hu
Applications: AC

Publications for GRIP1 Protein (NBP1-86252PEP) (0)

There are no publications for GRIP1 Protein (NBP1-86252PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRIP1 Protein (NBP1-86252PEP) (0)

There are no reviews for GRIP1 Protein (NBP1-86252PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GRIP1 Protein (NBP1-86252PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRIP1 Products

Research Areas for GRIP1 Protein (NBP1-86252PEP)

Find related products by research area.

Blogs on GRIP1

There are no specific blogs for GRIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GRIP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIP1