GRIM19 Antibody

Images

 
Western Blot: GRIM19 Antibody [NBP1-90050] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: GRIM19 Antibody [NBP1-90050] - Staining of human cell line U-251 MG shows positivity in mitochondria.
Immunohistochemistry-Paraffin: GRIM19 Antibody [NBP1-90050] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: GRIM19 Antibody [NBP1-90050] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRIM19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFA13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRIM19 Protein (NBP1-90050PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRIM19 Antibody

  • B16.6
  • CDA016
  • Cell death regulatory protein GRIM-19
  • cell death-regulatory protein GRIM19
  • CI-B16.6
  • complex I B16.6 subunit
  • Complex I-B16.6
  • FLJ58045
  • FLJ59191
  • Gene associated with retinoic and IFN-induced mortality 19 protein
  • Gene associated with retinoic and interferon-induced mortality 19 protein
  • GRIM-19CGI-39
  • GRIM19NADH-ubiquinone oxidoreductase B16.6 subunit
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-24535
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00004722-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF1458
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC

Publications for GRIM19 Antibody (NBP1-90050) (0)

There are no publications for GRIM19 Antibody (NBP1-90050).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRIM19 Antibody (NBP1-90050) (0)

There are no reviews for GRIM19 Antibody (NBP1-90050). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GRIM19 Antibody (NBP1-90050) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRIM19 Products

Bioinformatics Tool for GRIM19 Antibody (NBP1-90050)

Discover related pathways, diseases and genes to GRIM19 Antibody (NBP1-90050). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRIM19 Antibody (NBP1-90050)

Discover more about diseases related to GRIM19 Antibody (NBP1-90050).
 

Pathways for GRIM19 Antibody (NBP1-90050)

View related products by pathway.

Research Areas for GRIM19 Antibody (NBP1-90050)

Find related products by research area.

Blogs on GRIM19

There are no specific blogs for GRIM19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRIM19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA13