GR/NR3C1 Antibody

Images

 
Western Blot: GR/NR3C1 Antibody [NBP1-89733] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: GR/NR3C1 Antibody [NBP1-89733] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: GR/NR3C1 Antibody [NBP1-89733] - Staining of human lymph node shows strong nuclear positivity in reaction center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GR/NR3C1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NR3C1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GR/NR3C1 Protein (NBP1-89733PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GR/NR3C1 Antibody

  • GCR
  • glucocorticoid receptor
  • GR
  • GRGCCR
  • GRLNuclear receptor subfamily 3 group C member 1
  • NR3C1
  • nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
  • nuclear receptor subfamily 3, group C, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
7570-GH
Species: Hu
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89733
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GR/NR3C1 Antibody (NBP1-89733) (0)

There are no publications for GR/NR3C1 Antibody (NBP1-89733).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GR/NR3C1 Antibody (NBP1-89733) (0)

There are no reviews for GR/NR3C1 Antibody (NBP1-89733). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GR/NR3C1 Antibody (NBP1-89733) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GR/NR3C1 Products

Bioinformatics Tool for GR/NR3C1 Antibody (NBP1-89733)

Discover related pathways, diseases and genes to GR/NR3C1 Antibody (NBP1-89733). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GR/NR3C1 Antibody (NBP1-89733)

Discover more about diseases related to GR/NR3C1 Antibody (NBP1-89733).
 

Pathways for GR/NR3C1 Antibody (NBP1-89733)

View related products by pathway.

PTMs for GR/NR3C1 Antibody (NBP1-89733)

Learn more about PTMs related to GR/NR3C1 Antibody (NBP1-89733).
 

Research Areas for GR/NR3C1 Antibody (NBP1-89733)

Find related products by research area.

Blogs on GR/NR3C1

There are no specific blogs for GR/NR3C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GR/NR3C1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NR3C1
Entrez