GPT2 Antibody


Orthogonal Strategies: Western Blot: GPT2 Antibody [NBP2-14072] - Analysis in human cell lines Caco-2 and HeLa using anti-GPT2 antibody. Corresponding GPT2 RNA-seq data are presented for the same cell lines. more
Orthogonal Strategies: Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining in human stomach and lymph node tissues. Corresponding GPT2 RNA-seq data are presented for the same tissues.
Western Blot: GPT2 Antibody [NBP2-14072] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human lymph node shows very weak positivity in lymphoid cells.
Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human stomach shows moderate cytoplasmic positivity in parietal cells.
Simple Western: GPT2 Antibody [NBP2-14072] - Simple Western lane view shows a specific band for GPT2 in 0.2 mg/ml of HepG2 (left) and h. Kidney (right) lysate(s). This experiment was performed under reducing conditions more
Simple Western: GPT2 Antibody [NBP2-14072] - Electropherogram image of the corresponding Simple Western lane view. GPT2 antibody was used at 1:25 dilution on HepG2 and h. Kidney lysate(s) respectively.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

GPT2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLA
Specificity of human GPT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Simple Western 1:25
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size.
Control Peptide
GPT2 Protein (NBP2-14072PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GPT2 Antibody

  • AAT2
  • alanine aminotransferase 2
  • ALT2EC
  • Glutamate pyruvate transaminase 2
  • glutamic pyruvate transaminase (alanine aminotransferase) 2
  • Glutamic--alanine transaminase 2
  • glutamic-pyruvate transaminase 2
  • Glutamic--pyruvic transaminase 2
  • GPT 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for GPT2 Antibody (NBP2-14072) (0)

There are no publications for GPT2 Antibody (NBP2-14072).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPT2 Antibody (NBP2-14072) (0)

There are no reviews for GPT2 Antibody (NBP2-14072). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPT2 Antibody (NBP2-14072) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GPT2 Products

Bioinformatics Tool for GPT2 Antibody (NBP2-14072)

Discover related pathways, diseases and genes to GPT2 Antibody (NBP2-14072). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPT2 Antibody (NBP2-14072)

Discover more about diseases related to GPT2 Antibody (NBP2-14072).

Pathways for GPT2 Antibody (NBP2-14072)

View related products by pathway.

PTMs for GPT2 Antibody (NBP2-14072)

Learn more about PTMs related to GPT2 Antibody (NBP2-14072).

Blogs on GPT2

There are no specific blogs for GPT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GPT2 Antibody and receive a gift card or discount.


Gene Symbol GPT2