GPT2 Antibody

Images

 
Western Blot: GPT2 Antibody [NBP2-14072] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human lymph node shows very weak positivity in lymphoid cells.
Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human stomach shows moderate cytoplasmic positivity in parietal cells.
Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Simple Western: GPT2 Antibody [NBP2-14072] - Simple Western lane view shows a specific band for GPT2 in 0.2 mg/ml of HepG2 (left) and h. Kidney (right) lysate(s). This experiment was performed under reducing conditions ...read more
Simple Western: GPT2 Antibody [NBP2-14072] - Electropherogram image of the corresponding Simple Western lane view. GPT2 antibody was used at 1:25 dilution on HepG2 and h. Kidney lysate(s) respectively.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Simple Western 1:25
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size.
Control Peptide
GPT2 Protein (NBP2-14072PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPT2 Antibody

  • AAT2
  • alanine aminotransferase 2
  • ALT2EC 2.6.1.2
  • Glutamate pyruvate transaminase 2
  • glutamic pyruvate transaminase (alanine aminotransferase) 2
  • Glutamic--alanine transaminase 2
  • glutamic-pyruvate transaminase 2
  • Glutamic--pyruvic transaminase 2
  • GPT 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-45449
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3025
Species: Hu
Applications: WB, ICC
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for GPT2 Antibody (NBP2-14072) (0)

There are no publications for GPT2 Antibody (NBP2-14072).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPT2 Antibody (NBP2-14072) (0)

There are no reviews for GPT2 Antibody (NBP2-14072). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPT2 Antibody (NBP2-14072) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPT2 Products

Bioinformatics Tool for GPT2 Antibody (NBP2-14072)

Discover related pathways, diseases and genes to GPT2 Antibody (NBP2-14072). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPT2 Antibody (NBP2-14072)

Discover more about diseases related to GPT2 Antibody (NBP2-14072).
 

Pathways for GPT2 Antibody (NBP2-14072)

View related products by pathway.

PTMs for GPT2 Antibody (NBP2-14072)

Learn more about PTMs related to GPT2 Antibody (NBP2-14072).

Blogs on GPT2

There are no specific blogs for GPT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPT2