GPR37L1 Antibody - BSA Free

Immunohistochemistry-Paraffin: GPR37L1 Antibody [NBP2-49419] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry: GPR37L1 Antibody [NBP2-49419] - Staining of human cerebellum shows moderate positivity in the molecular layer.

Immunohistochemistry-Paraffin: GPR37L1 Antibody [NBP2-49419] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: GPR37L1 Antibody [NBP2-49419] - Staining in human cerebral cortex and pancreas tissues using anti-GPR37L1 antibody. Corresponding GPR37L1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPR37L1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPR37L1 Antibody - BSA Free (NBP2-49419) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR37L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP)

Reactivity Notes

Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GPR37L1 Antibody - BSA Free

• endothelin B receptor-like protein 2
• ET(B)R-LP-2
• ETBRLP2
• ETBR-LP-2
• ETBR-LP-2endothelin type b receptor-like protein 2
• G protein-coupled receptor 37 like 1
• GPR37L1
• G-protein coupled receptor 37 like 1
• G-protein coupled receptor 37-like 1

Background

ETBR-LP-2 is an Orphan-A GPCR with an unknown ligand. Endothelin Type B Receptor-Like Protein 2 (ETBR-LP-2) has been reported in human brain. ESTs have been isolated from human brain and colon libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR37L1