Endothelin 2 Antibody

Images

 
Western Blot: Endothelin 2 Antibody [NBP1-87942] - Analysis in control (vector only transfected HEK293T lysate) and EDN2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: Endothelin 2 Antibody [NBP1-87942] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: Endothelin 2 Antibody [NBP1-87942] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Endothelin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EDN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 24913676). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Endothelin 2 Protein (NBP1-87942PEP)
Publications
Read Publication using NBP1-87942.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Endothelin 2 Antibody

  • EDN2
  • endothelin 2
  • Endothelin2
  • Endothelin-2
  • ET2
  • ET-2
  • PPET2
  • preproendothelin 2
  • preproendothelin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5579
Species: Hu
Applications: ICC
QET00B
Species: Hu
Applications: ELISA
NLS54
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-836
Species: Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF1784
Species: Hu
Applications: CyTOF-ready, IHC, IP, ICFlow, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-24916
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NBP1-89993
Species: Hu
Applications: IHC, IHC-P, WB
MAB16451
Species: Hu
Applications: IHC, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-87942
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Endothelin 2 Antibody (NBP1-87942)(1)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for Endothelin 2 Antibody (NBP1-87942) (0)

There are no reviews for Endothelin 2 Antibody (NBP1-87942). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Endothelin 2 Antibody (NBP1-87942) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Endothelin 2 Products

Bioinformatics Tool for Endothelin 2 Antibody (NBP1-87942)

Discover related pathways, diseases and genes to Endothelin 2 Antibody (NBP1-87942). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Endothelin 2 Antibody (NBP1-87942)

Discover more about diseases related to Endothelin 2 Antibody (NBP1-87942).
 

Pathways for Endothelin 2 Antibody (NBP1-87942)

View related products by pathway.

PTMs for Endothelin 2 Antibody (NBP1-87942)

Learn more about PTMs related to Endothelin 2 Antibody (NBP1-87942).
 

Research Areas for Endothelin 2 Antibody (NBP1-87942)

Find related products by research area.

Blogs on Endothelin 2

There are no specific blogs for Endothelin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Endothelin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EDN2