GPR177/WLS Antibody


Western Blot: GPR177/WLS Antibody [NBP2-57299] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: GPR177/WLS Antibody [NBP2-57299] - Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in cytotrophoblastic cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GPR177/WLS Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD
Specificity of human GPR177/WLS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPR177/WLS Recombinant Protein Antigen (NBP2-57299PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for GPR177/WLS Antibody

  • C1orf139
  • DKFZp686I0788
  • Evi
  • EVIchromosome 1 open reading frame 139
  • FLJ23091
  • G protein-coupled receptor 177
  • GPR177
  • GPR177wls
  • Integral membrane protein GPR177
  • MGC131760
  • MGC14878
  • MRP
  • Protein evenness interrupted homolog
  • protein wntless homolog
  • Putative NF-kappa-B-activating protein 373
  • putative NFkB activating protein 373
  • Sprinter
  • WLS
  • wntless homolog (Drosophila)
  • Wntless


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF
Species: Mu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, IHC
Species: Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GPR177/WLS Antibody (NBP2-57299) (0)

There are no publications for GPR177/WLS Antibody (NBP2-57299).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR177/WLS Antibody (NBP2-57299) (0)

There are no reviews for GPR177/WLS Antibody (NBP2-57299). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR177/WLS Antibody (NBP2-57299) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for GPR177/WLS Antibody (NBP2-57299)

Discover related pathways, diseases and genes to GPR177/WLS Antibody (NBP2-57299). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR177/WLS Antibody (NBP2-57299)

Discover more about diseases related to GPR177/WLS Antibody (NBP2-57299).

Pathways for GPR177/WLS Antibody (NBP2-57299)

View related products by pathway.

PTMs for GPR177/WLS Antibody (NBP2-57299)

Learn more about PTMs related to GPR177/WLS Antibody (NBP2-57299).

Research Areas for GPR177/WLS Antibody (NBP2-57299)

Find related products by research area.

Blogs on GPR177/WLS

There are no specific blogs for GPR177/WLS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GPR177/WLS Antibody and receive a gift card or discount.


Gene Symbol WLS