GPR177/WLS Antibody

Images

 
Western Blot: GPR177/WLS Antibody [NBP2-57299] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: GPR177/WLS Antibody [NBP2-57299] - Staining of human placenta shows strong cytoplasmic positivity in cytotrophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR177/WLS Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD
Specificity
Specificity of human GPR177/WLS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WLS
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPR177/WLS Recombinant Protein Antigen (NBP2-57299PEP)
Reviewed Applications
Read 1 Review rated 1
using
NBP2-57299 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GPR177/WLS Antibody

  • C1orf139
  • DKFZp686I0788
  • Evi
  • EVIchromosome 1 open reading frame 139
  • FLJ23091
  • G protein-coupled receptor 177
  • GPR177
  • GPR177wls
  • Integral membrane protein GPR177
  • MGC131760
  • MGC14878
  • MRP
  • Protein evenness interrupted homolog
  • protein wntless homolog
  • Putative NF-kappa-B-activating protein 373
  • putative NFkB activating protein 373
  • Sprinter
  • WLS
  • wntless homolog (Drosophila)
  • Wntless

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82820
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF6278
Species: Hu, Mu
Applications: WB
NBP2-67117
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Pm, Pm, Rb
Applications: IHC, IHC-P
NB100-64808
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP, IF
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NBP2-46467
Species: Hu
Applications: WB, IHC
NB110-89726
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GPR177/WLS Antibody (NBP2-57299) (0)

There are no publications for GPR177/WLS Antibody (NBP2-57299).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for GPR177/WLS Antibody (NBP2-57299) (1) 11

Average Rating: 1
(Based on 1 review)
We have 1 review tested in 1 species: Pig.

Reviews using NBP2-57299:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Pig
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot GPR177/WLS NBP2-57299
Enlarge
reviewed by:
Annemette Boe Marnow
WB Pig 06/16/2020
View

Summary

ApplicationWestern Blot
Sample Testedpig endothelial cells
SpeciesPig
Lot000010209

Comments

Comments*Low Rating Note: Novus Innovators Program - new species or application used on a primary antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR177/WLS Antibody (NBP2-57299) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GPR177/WLS Products

Bioinformatics Tool for GPR177/WLS Antibody (NBP2-57299)

Discover related pathways, diseases and genes to GPR177/WLS Antibody (NBP2-57299). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR177/WLS Antibody (NBP2-57299)

Discover more about diseases related to GPR177/WLS Antibody (NBP2-57299).
 

Pathways for GPR177/WLS Antibody (NBP2-57299)

View related products by pathway.

PTMs for GPR177/WLS Antibody (NBP2-57299)

Learn more about PTMs related to GPR177/WLS Antibody (NBP2-57299).
 

Research Areas for GPR177/WLS Antibody (NBP2-57299)

Find related products by research area.

Blogs on GPR177/WLS

There are no specific blogs for GPR177/WLS, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

1
5
0
4
0
3
0
2
0
1
1

Annemette Boe Marnow
06/16/2020
Application: WB
Species: Pig

Bioinformatics

Gene Symbol WLS