GPR177/WLS Antibody


Western Blot: GPR177/WLS Antibody [NBP2-57299] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: GPR177/WLS Antibody [NBP2-57299] - Staining of human placenta shows strong cytoplasmic positivity in cytotrophoblastic cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GPR177/WLS Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPR177/WLS Recombinant Protein Antigen (NBP2-57299PEP)
Reviewed Applications
Read 1 Review rated 1
NBP2-57299 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for GPR177/WLS Antibody

  • C1orf139
  • DKFZp686I0788
  • Evi
  • EVIchromosome 1 open reading frame 139
  • FLJ23091
  • G protein-coupled receptor 177
  • GPR177
  • GPR177wls
  • Integral membrane protein GPR177
  • MGC131760
  • MGC14878
  • MRP
  • Protein evenness interrupted homolog
  • protein wntless homolog
  • Putative NF-kappa-B-activating protein 373
  • putative NFkB activating protein 373
  • Sprinter
  • WLS
  • wntless homolog (Drosophila)
  • Wntless


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, Flow, IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Mu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Mu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GPR177/WLS Antibody (NBP2-57299) (0)

There are no publications for GPR177/WLS Antibody (NBP2-57299).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for GPR177/WLS Antibody (NBP2-57299) (1) 11

Average Rating: 1
(Based on 1 review)
We have 1 review tested in 1 species: Pig.

Reviews using NBP2-57299:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot GPR177/WLS NBP2-57299
reviewed by:
Verified Customer
WB Pig 06/16/2020


ApplicationWestern Blot
Sample Testedpig endothelial cells


Comments*Low Rating Note: Novus Innovators Program - new species or application used on a primary antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR177/WLS Antibody (NBP2-57299) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GPR177/WLS Products

Bioinformatics Tool for GPR177/WLS Antibody (NBP2-57299)

Discover related pathways, diseases and genes to GPR177/WLS Antibody (NBP2-57299). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR177/WLS Antibody (NBP2-57299)

Discover more about diseases related to GPR177/WLS Antibody (NBP2-57299).

Pathways for GPR177/WLS Antibody (NBP2-57299)

View related products by pathway.

PTMs for GPR177/WLS Antibody (NBP2-57299)

Learn more about PTMs related to GPR177/WLS Antibody (NBP2-57299).

Research Areas for GPR177/WLS Antibody (NBP2-57299)

Find related products by research area.

Blogs on GPR177/WLS

There are no specific blogs for GPR177/WLS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Verified Customer
Application: WB
Species: Pig


Gene Symbol WLS