![Western Blot: GRP177 Antibody [NBP1-59013] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/GRP177-Antibody-Western-Blot-NBP1-59013-img0002.jpg "Western Blot: GRP177 Antibody [NBP1-59013] - Human Liver cell lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptides corresponding to GPR177(G protein-coupled receptor 177) The peptide sequence was selected from the middle region of GPR177. Peptide sequence DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WLS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This is a rabbit polyclonal antibody against GPR177 and was validated on Western blot. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunohistochemistry-Paraffin-NBP2-67667-img0001.jpg)
-Immunohistochemistry-Frozen-NBP2-67667-img0004.jpg)
-Immunohistochemistry-Paraffin-NBP2-67667-img0003.jpg)
-Dual-RNAscope-ISH-IHC-NB400-156-img0008.jpg)
-Western-Blot-NB400-156-img0006.jpg)
-Immunocytochemistry-Immunofluorescence-NB400-156-img0007.jpg)
---Azide-and-BSA-Free-Immunohistochemistry-Paraffin-NBP2-79854-img0001.jpg)
---Azide-and-BSA-Free-Immunohistochemistry-Paraffin-NBP2-79854-img0002.jpg)
---Azide-and-BSA-Free-Immunohistochemistry-Paraffin-NBP2-79854-img0003.jpg)
| Publications using NBP1-59013 | Applications | Species |
|---|---|---|
| Mohamed R, Kennedy C, Willmore WG Responses of porcupine and Wntless proteins to oxidative, hypoxic and endoplasmic reticulum stresses Cellular signalling 2021-05-17 [PMID: 34015469] (WB) | WB | |
| Clinch M The Role of Hypoxia on PORCN and WLS Expression in Human Embryonic Kidney (HEK293T) and Human Colon Cancer (HCT-116T) Cells Carleton University 2022-04-05 (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for GPR177/WLS Antibody (NBP1-59013)Discover more about diseases related to GPR177/WLS Antibody (NBP1-59013).
| Pathways for GPR177/WLS Antibody (NBP1-59013)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
-ELISA-NBP2-22124-img0001.jpg)
-Flow-Cytometry-NBP2-22124-img0003.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-22124-img0004.jpg)
-Immunohistochemistry-NB100-64808-img0001.jpg)
-Immunohistochemistry-NB100-64808-img0002.jpg)
-Immunohistochemistry-NB100-64808-img0003.jpg)
![Immunocytochemistry S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry_6489.jpg)
![Western Blot S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry__Immunofluorescence_17308.jpg)
![Simple Western S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Simple_Western_18694.jpg)
-Immunohistochemistry-NBP2-46467-img0001.jpg)
-Immunohistochemistry-NBP2-46467-img0002.jpg)
-Immunohistochemistry-NBP2-46467-img0003.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry_6480.jpg)
![Immunohistochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunohistochemistry_22376.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry__Immunofluorescence_22492.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")