GPR103 Antibody

Images

 
Immunohistochemistry: GPR103 Antibody [NBP1-89740] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR103 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
QRFPR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPR103 Protein (NBP1-89740PEP)
Publications
Read Publication using NBP1-89740.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (83%). Reactivity reported in scientific literature (PMID: 22465717)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR103 Antibody

  • AQ27
  • G protein-coupled receptor 103
  • GPR103
  • G-protein coupled receptor 103
  • MGC149217
  • Orexigenic neuropeptide QRFP receptor
  • pyroglutamylated RFamide peptide receptor
  • QRFP receptor
  • QRFPR
  • SP9155

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-94144
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86724
Species: Hu
Applications: WB, IHC, IHC-P
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB110-40561
Species: Hu
Applications: WB, IP
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
MAB763
Species: Hu, Mu, Rt
Applications: IHC
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
NBP1-89740
Species: Hu
Applications: IHC, IHC-P

Publications for GPR103 Antibody (NBP1-89740)(1)

Reviews for GPR103 Antibody (NBP1-89740) (0)

There are no reviews for GPR103 Antibody (NBP1-89740). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPR103 Antibody (NBP1-89740) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR103 Products

Bioinformatics Tool for GPR103 Antibody (NBP1-89740)

Discover related pathways, diseases and genes to GPR103 Antibody (NBP1-89740). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR103 Antibody (NBP1-89740)

Discover more about diseases related to GPR103 Antibody (NBP1-89740).
 

Pathways for GPR103 Antibody (NBP1-89740)

View related products by pathway.

Research Areas for GPR103 Antibody (NBP1-89740)

Find related products by research area.

Blogs on GPR103

There are no specific blogs for GPR103, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR103 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol QRFPR
Entrez