NPVF Antibody

Images

 
Western Blot: NPVF Antibody [NBP1-86724] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: NPVF Antibody [NBP1-86724] - Staining of human eye, retina shows strong positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NPVF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPVF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NPVF Recombinant Protein Antigen (NBP1-86724PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NPVF Antibody

  • C7orf9
  • FMRFamide-related peptides
  • neuropeptide NPVF
  • neuropeptide VF precursor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS1903
Species: Bv, Eq, Hu, Pm, Po, Pm, Rb
Applications: IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP3-05565
Species: Hu, Rt
Applications: WB
H00003814-M05
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-81671
Species: Ch, Hu, Mu
Applications: ChIP, IP, WB
DY795
Species: Hu
Applications: ELISA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-76909
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NLS1922
Species: Hu
Applications: IHC, IHC-P
NLS418
Species: Hu
Applications: IHC, IHC-P
NBP2-14321
Species: Hu
Applications: IHC, IHC-P, WB
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
664-LI/CF
Species: Hu
Applications: BA
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF6989
Species: Mu
Applications: IHC
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NBP1-86724
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NPVF Antibody (NBP1-86724) (0)

There are no publications for NPVF Antibody (NBP1-86724).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPVF Antibody (NBP1-86724) (0)

There are no reviews for NPVF Antibody (NBP1-86724). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NPVF Antibody (NBP1-86724) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NPVF Products

Bioinformatics Tool for NPVF Antibody (NBP1-86724)

Discover related pathways, diseases and genes to NPVF Antibody (NBP1-86724). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPVF Antibody (NBP1-86724)

Discover more about diseases related to NPVF Antibody (NBP1-86724).
 

Pathways for NPVF Antibody (NBP1-86724)

View related products by pathway.

PTMs for NPVF Antibody (NBP1-86724)

Learn more about PTMs related to NPVF Antibody (NBP1-86724).

Blogs on NPVF

There are no specific blogs for NPVF, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPVF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPVF