GPD2 Antibody

Images

 
Western Blot: GPD2 Antibody [NBP1-62388] - ACHN cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPD2 Antibody Summary

Immunogen
Synthetic peptides corresponding to GPD2(glycerol-3-phosphate dehydrogenase 2 (mitochondrial)) The peptide sequence was selected form the middle region of GPD2. Peptide sequence GQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against GPD2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GPD2 Antibody

  • EC 1.1.5.3
  • GDH2
  • glycerol-3-phosphate dehydrogenase 2 (mitochondrial)
  • GPD2
  • GPDH-M
  • GPDM
  • GPD-M
  • mGDH
  • mGPDH
  • mitochondrial glycerophosphate dehydrogenase
  • mitochondrial
  • mtGPD

Background

The protein encoded by this gene localizes to the inner mitochondrial membrane and catalyzes the conversion of glycerol-3-phosphate to dihydroxyacetone phosphate, using FAD as a cofactor. Along with GDP1, the encoded protein constitutes the glycerol phosp

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16679
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-87411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-02615
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF6695
Species: Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
NBP3-15687
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-84597
Species: Hu
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
NB100-1992
Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-62388
Species: Hu
Applications: WB

Publications for GPD2 Antibody (NBP1-62388) (0)

There are no publications for GPD2 Antibody (NBP1-62388).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPD2 Antibody (NBP1-62388) (0)

There are no reviews for GPD2 Antibody (NBP1-62388). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPD2 Antibody (NBP1-62388) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPD2 Products

Array NBP1-62388

Bioinformatics Tool for GPD2 Antibody (NBP1-62388)

Discover related pathways, diseases and genes to GPD2 Antibody (NBP1-62388). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPD2 Antibody (NBP1-62388)

Discover more about diseases related to GPD2 Antibody (NBP1-62388).
 

Pathways for GPD2 Antibody (NBP1-62388)

View related products by pathway.

PTMs for GPD2 Antibody (NBP1-62388)

Learn more about PTMs related to GPD2 Antibody (NBP1-62388).
 

Research Areas for GPD2 Antibody (NBP1-62388)

Find related products by research area.

Blogs on GPD2

There are no specific blogs for GPD2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPD2
OMIM
Uniprot