GPAM Antibody

Images

 
Immunohistochemistry-Paraffin: GPAM Antibody [NBP2-14065] Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPAM Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: INETHTRHRGWLARRLSYVLFIQERDVHKGMFATNVTENVLNSSRVQEAI AEVAAELNPDGSAQQQSKAVNKVKKKAKRILQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPAM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPAM Protein (NBP2-14065PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPAM Antibody

  • EC 2.3.1
  • EC 2.3.1.15
  • glycerol-3-phosphate acyltransferase 1, mitochondrial
  • glycerol-3-phosphate acyltransferase, mitochondrial
  • GPAT
  • GPAT-1
  • GPAT1mitochondrial
  • MGC26846

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008443-B01P
Species: Hu
Applications: WB, ICC/IF
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF6898
Species: Hu, Mu, Rt
Applications: WB
NB100-2390
Species: Hu, Mu, Pm
Applications: WB
AF7550
Species: Hu
Applications: WB
NBP1-82236
Species: Hu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84360
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71701
Species: Hu, Mu
Applications: WB
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-14065
Species: Hu
Applications: IHC, IHC-P

Publications for GPAM Antibody (NBP2-14065) (0)

There are no publications for GPAM Antibody (NBP2-14065).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPAM Antibody (NBP2-14065) (0)

There are no reviews for GPAM Antibody (NBP2-14065). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPAM Antibody (NBP2-14065) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPAM Products

Bioinformatics Tool for GPAM Antibody (NBP2-14065)

Discover related pathways, diseases and genes to GPAM Antibody (NBP2-14065). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPAM Antibody (NBP2-14065)

Discover more about diseases related to GPAM Antibody (NBP2-14065).
 

Pathways for GPAM Antibody (NBP2-14065)

View related products by pathway.

PTMs for GPAM Antibody (NBP2-14065)

Learn more about PTMs related to GPAM Antibody (NBP2-14065).

Blogs on GPAM

There are no specific blogs for GPAM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPAM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPAM