GPAT2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GPAT2 Antibody [NBP1-84360] - Staining of human cell line BJ shows localization to mitochondria.

Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPAT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPAT2 Antibody - BSA Free (NBP1-84360) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-GPAT2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HQKGVFLSQLLGEFSWLTEEILLRGFDVGFSGQLRSLLQHSLSLLRAHVALLRIRQGDLLVVPQPGPGLTHLA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPAT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC reported in scientific literature (PMID: 24967918). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GPAT2 Protein (NBP1-84360PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%). Human reactivity reported in scientific literature (PMID: 24967918).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GPAT2 Antibody - BSA Free

• ALPAAB
• BSCL
• BSCL1
• cancer/testis antigen 123
• CT123
• EC 2.3.1.15
• glycerol-3-phosphate acyltransferase 2, mitochondrial
• GPAT-2
• xGPAT1

Background

Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step inglycerolipid biosynthesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GPAT2 Antibody (NBP1-84360)(2)

Publications using NBP1-84360

• Pellon-Maison M, Montanaro MA, Lacunza E et al. Glycerol-3-Phosphate Acyltranferase-2 Behaves as a Cancer Testis Gene and Promotes Growth and Tumorigenicity of the Breast Cancer MDA-MB-231 Cell Line. PLoS One 2014-01-01 [PMID: 24967918] (IF/IHC, Human)
• Cattaneo ER, Pellon-Maison M, Rabassa ME et al. Glycerol-3-phosphate acyltransferase-2 is expressed in spermatic germ cells and incorporates arachidonic acid into triacylglycerols. PLoS One 2012-01-01 [PMID: 22905194]

Bioinformatics

• Gene Symbol: GPAT2