GPAT2 Antibody


Immunocytochemistry/ Immunofluorescence: GPAT2 Antibody [NBP1-84360] - Staining of human cell line BJ shows localization to mitochondria.
Immunohistochemistry-Paraffin: GPAT2 Antibody [NBP1-84360] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

GPAT2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: HQKGVFLSQLLGEFSWLTEEILLRGFDVGFSGQLRSLLQHSLSLLRAHVALLRIRQGDLLVVPQPGPGLTHLA
Specificity of human GPAT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPAT2 Protein (NBP1-84360PEP)
Read Publications using
NBP1-84360 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%). Human reactivity reported in scientific literature (PMID: 24967918).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GPAT2 Antibody

  • BSCL
  • BSCL1
  • cancer/testis antigen 123
  • CT123
  • EC
  • glycerol-3-phosphate acyltransferase 2, mitochondrial
  • GPAT-2
  • xGPAT1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Pm
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GPAT2 Antibody (NBP1-84360)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for GPAT2 Antibody (NBP1-84360) (0)

There are no reviews for GPAT2 Antibody (NBP1-84360). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GPAT2 Antibody (NBP1-84360) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GPAT2 Products

Bioinformatics Tool for GPAT2 Antibody (NBP1-84360)

Discover related pathways, diseases and genes to GPAT2 Antibody (NBP1-84360). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPAT2 Antibody (NBP1-84360)

Discover more about diseases related to GPAT2 Antibody (NBP1-84360).

Pathways for GPAT2 Antibody (NBP1-84360)

View related products by pathway.

PTMs for GPAT2 Antibody (NBP1-84360)

Learn more about PTMs related to GPAT2 Antibody (NBP1-84360).

Blogs on GPAT2

There are no specific blogs for GPAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GPAT2 Antibody and receive a gift card or discount.


Gene Symbol GPAT2