GOLGB1/Giantin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GOLGB1/Giantin Antibody [NBP1-91937] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GOLGB1/Giantin Antibody [NBP1-91937] - Staining of human kidney.
Immunohistochemistry-Paraffin: GOLGB1/Giantin Antibody [NBP1-91937] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GOLGB1/Giantin Antibody [NBP1-91937] - Staining of human cerebral cortex, colon, epididymis and kidney using Anti-GOLGB1 antibody NBP1-91937 (A) shows similar protein distribution across ...read more
Immunohistochemistry-Paraffin: GOLGB1/Giantin Antibody [NBP1-91937] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: GOLGB1/Giantin Antibody [NBP1-91937] - Staining of human colon.
Immunohistochemistry-Paraffin: GOLGB1/Giantin Antibody [NBP1-91937] - Staining of human epididymis.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GOLGB1/Giantin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KHDNQTNVTEEGTQSIPGETEEQDSLSMSTRPTCSESVPSAKSANPAVSKDFSSHDEINNYLQQIDQLKERIAGLEEEKQKNKEFSQTLENEKNTLLSQISTKDGELKMLQEEVTKMNLLNQQIQEELS
Marker
Golgi Apparatus Marker
Specificity
Specificity of human GOLGB1/Giantin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GOLGB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
GOLGB1/Giantin Protein (NBP1-91937PEP)
Publications
Read Publications using
NBP1-91937 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25359980).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GOLGB1/Giantin Antibody

  • 372 kDa Golgi complex-associated protein
  • GCP
  • GCP372
  • GCP372GIANTIN
  • Giantin
  • GOLGB1
  • golgi autoantigen, golgin subfamily b, macrogolgin (with transmembrane signal)1,macrogolgin
  • golgi integral membrane protein 1
  • golgin B1
  • golgin B1, golgi integral membrane protein
  • Golgin subfamily B member 1
  • GOLIM1
  • Macrogolgin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53420
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-75515
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-64634
Species: Hu
NBP1-83352
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38528
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GOLGB1/Giantin Antibody (NBP1-91937)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GOLGB1/Giantin Antibody (NBP1-91937) (0)

There are no reviews for GOLGB1/Giantin Antibody (NBP1-91937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GOLGB1/Giantin Antibody (NBP1-91937) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GOLGB1/Giantin Antibody (NBP1-91937)

Discover related pathways, diseases and genes to GOLGB1/Giantin Antibody (NBP1-91937). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GOLGB1/Giantin Antibody (NBP1-91937)

Discover more about diseases related to GOLGB1/Giantin Antibody (NBP1-91937).
 

Pathways for GOLGB1/Giantin Antibody (NBP1-91937)

View related products by pathway.

Research Areas for GOLGB1/Giantin Antibody (NBP1-91937)

Find related products by research area.

Blogs on GOLGB1/Giantin

There are no specific blogs for GOLGB1/Giantin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GOLGB1/Giantin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLGB1
Entrez
Uniprot