GOLGB1/Giantin Antibody - BSA Free

Immunohistochemistry-Paraffin: GOLGB1/Giantin Antibody [NBP1-91937] - Staining of human endometrium, gastrointestinal, kidney and prostate using Anti-GOLGB1/Giantin antibody NBP1-91937 (A) shows similar protein distribution across tissues to independent antibody NBP1-91938 (B).

Immunocytochemistry/Immunofluorescence: GOLGB1/Giantin Antibody [NBP1-91937] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GOLGB1/Giantin Antibody [NBP1-91937] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: GOLGB1/Giantin Antibody [NBP1-91937] - Staining of human colon.

Immunohistochemistry-Paraffin: GOLGB1/Giantin Antibody [NBP1-91937] - Staining of human kidney.

Immunohistochemistry-Paraffin: GOLGB1/Giantin Antibody [NBP1-91937] - Staining of human epididymis.

Staining of human prostate shows strong positivity in Golgi apparatus in glandular cells.

Staining of human endometrium).

Staining of human endometrium shows strong positivity in Golgi apparatus in glandular cells.

Staining of human kidney shows strong positivity in Golgi apparatus in cells in tubules.

Staining of human duodenum shows strong positivity in Golgi apparatus in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GOLGB1/Giantin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KHDNQTNVTEEGTQSIPGETEEQDSLSMSTRPTCSESVPSAKSANPAVSKDFSSHDEINNYLQQIDQLKERIAGLEEEKQKNKEFSQTLENEKNTLLSQISTKDGELKMLQEEVTKMNLLNQQIQEELS
• Marker: Golgi Apparatus Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GOLGB1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100.
• Control Peptide:

  GOLGB1/Giantin Protein (NBP1-91937PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GOLGB1/Giantin Antibody - BSA Free

• 372 kDa Golgi complex-associated protein
• GCP
• GCP372
• GCP372GIANTIN
• Giantin
• GOLGB1
• golgi autoantigen, golgin subfamily b, macrogolgin (with transmembrane signal)1,macrogolgin
• golgi integral membrane protein 1
• golgin B1
• golgin B1, golgi integral membrane protein
• Golgin subfamily B member 1
• GOLIM1
• Macrogolgin

Background

The giantin (GOLGB1) gene codes for a golgin subfamily B member 1 protein that exists in isoform 1 at a length of 3,259 amino acids and a mass of 376 kDa or isoform 2 at 3,269 amino acids long and 377 kDA. GOLGB1 is thought to participate in the development of intercisternal cross-bridges of the Golgi complex. Researchers have investigated its role in hypertension, myopathy, hematopoiesis, encephalitis, and arthritis. GOLGB1 is known to interact with other genes such as PFN2, CAV2, USO1, SLC2A3, and GORASP2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GOLGB1/Giantin Antibody (NBP1-91937)(2)

Publications using NBP1-91937

• Wong M, Munro S. The specificity of vesicle traffic to the Golgi is encoded in the golgin coiled-coil proteins. Science 2014-10-31 [PMID: 25359980] (ICC/IF, Human)
• Rosa-Ferreira C, Munro S et al. Arl8 and SKIP act together to link lysosomes to kinesin-1. Dev Cell 2011-12-01 [PMID: 22172677]

Bioinformatics

• Gene Symbol: GOLGB1
• Entrez:
  • 2804(Human)
• Uniprot:
  • Q14789()