GOLGA5 Antibody - BSA Free

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining in human epididymis and skeletal muscle tissues using NBP1-83352 antibody. Corresponding GOLGA5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human cerebellum, epididymis, stomach and testis using Anti-GOLGA5 antibody NBP1-83352 (A) shows similar protein distribution across tissues to independent antibody NBP2-39007 (B).

Immunocytochemistry/Immunofluorescence: GOLGA5 Antibody [NBP1-83352] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry: GOLGA5 Antibody [NBP1-83352] - Staining of mouse motor cortex shows strong cytoplasmic immunoreactivity in neurons.

Immunohistochemistry: GOLGA5 Antibody [NBP1-83352] - Staining of mouse thalamus shows positivity in neuronal cell bodies in ventral anterior nucleus.

Immunohistochemistry: GOLGA5 Antibody [NBP1-83352] - Staining of mouse hippocampus shows immunoreactivity in a subset of neurons in the CA3 area.

Immunohistochemistry: GOLGA5 Antibody [NBP1-83352] - Staining of mouse mesencephalic reticular formation shows strong immunoreactivity in a subset of neurons.

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human epididymis shows strong positivity in Golgi apparatus in glandular cells.

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human stomach shows moderate to strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in cells in seminiferous ducts.

Analysis in U-87MG ATCC cells) transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GOLGA5 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Staining of mouse globus pallidus shows positivity in neuronal cell bodies.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GOLGA5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GOLGA5 Antibody - BSA Free (NBP1-83352) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-GOLGA5 Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACPDHTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKV
• Marker: Golgi Apparatus Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GOLGA5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GOLGA5 Protein (NBP1-83352PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:31628189).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GOLGA5 Antibody - BSA Free

• Cell proliferation-inducing gene 31 protein
• golgi autoantigen, golgin subfamily a, 5
• golgin A5
• Golgin subfamily A member 5
• Golgin-84
• GOLIM5
• Protein Ret-II
• PTC5
• RET-fused gene 5 protein
• RETII
• ret-II
• rfg5
• RFG5golgi integral membrane protein 5

Background

The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues; the chimeric sequences have been designated RET-II and PTC5. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GOLGA5 Antibody (NBP1-83352)(7)

Publications using NBP1-83352

• Li Y, Ma B, Lu J et al. Lysosome-Featured Cell Aggregate-Released Extracellular Vesicles Regulate Iron Homeostasis and Alleviate Post-Irradiation Endothelial Ferroptosis for Mandibular Regeneration. Advanced science (Weinheim, Baden-Wurttemberg, Germany) 2025-06-23 [PMID: 40546115]
• Cao Y, Ying S, Qiu X et al. Proteomic Analysis Identifies Stomatin as a Biological Marker for Psychological Stress SSRN Electronic Journal 2022-08-16 [PMID: 36636173] (WB, Mouse)
• Yang X, Yamazaki H, Yamakoshi Y et al. Trafficking and secretion of keratin 75 by ameloblasts in vivo J. Biol. Chem. 2019-11-29 [PMID: 31628189] (IHC-P, Mouse)
• Wong M, Munro S. The specificity of vesicle traffic to the Golgi is encoded in the golgin coiled-coil proteins. Science 2014-10-31 [PMID: 25359980] (ICC/IF, Human)
• Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696]
• Hsu YC, Jensen AM et al. Multiple domains in the Crumbs Homolog 2a (Crb2a) protein are required for regulating rod photoreceptor size. BMC Cell Biol 2010-07-01 [PMID: 20670434]
• Mulder J, Wernerus H, Shi TJ et al. Systematically generated antibodies against human gene products: high throughput screening on sections from the rat nervous system. Neuroscience 2007-06-08 [PMID: 17478047]

Bioinformatics

• Gene Symbol: GOLGA5