GOLGA5 Antibody

Images

 
Western Blot: GOLGA5 Antibody [NBP1-83352] - Analysis in human cell line U-87 MG.
Immunocytochemistry/ Immunofluorescence: GOLGA5 Antibody [NBP1-83352] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human hippocampus shows moderate granular immunoreactivity in neurons.
Immunocytochemistry/ Immunofluorescence: GOLGA5 Antibody [NBP1-83352] - Staining of mouse globus pallidus shows positivity in neuronal cell bodies.
Immunocytochemistry/ Immunofluorescence: GOLGA5 Antibody [NBP1-83352] - Staining of mouse motor cortex shows strong cytoplasmic immunoreactivity in neurons.
Immunocytochemistry/ Immunofluorescence: GOLGA5 Antibody [NBP1-83352] - Staining of mouse thalamus shows positivity in neuronal cell bodies in ventral anterior nucleus.
Immunocytochemistry/ Immunofluorescence: GOLGA5 Antibody [NBP1-83352] - Staining of mouse hippocampus shows immunoreactivity in a subset of neurons in the CA3 area.
Immunocytochemistry/ Immunofluorescence: GOLGA5 Antibody [NBP1-83352] - Staining of mouse mesencephalic reticular formation shows strong immunoreactivity in a subset of neurons.
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human stomach shows strong granular positivity in cytoplasm of glandular cells.
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human cerebral cortex shows granular cytoplasmic immunoreactivity in neurons.
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cell bodies

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GOLGA5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACPDHTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKV
Marker
Golgi Apparatus Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GOLGA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GOLGA5 Protein (NBP1-83352PEP)
Publications
Read Publications using
NBP1-83352 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25359980).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GOLGA5 Antibody

  • Cell proliferation-inducing gene 31 protein
  • golgi autoantigen, golgin subfamily a, 5
  • golgin A5
  • Golgin subfamily A member 5
  • Golgin-84
  • GOLIM5
  • Protein Ret-II
  • PTC5
  • RET-fused gene 5 protein
  • RETII
  • ret-II
  • rfg5
  • RFG5golgi integral membrane protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91937
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-53420
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94105
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-88946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91954
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut

Publications for GOLGA5 Antibody (NBP1-83352)(4)

Reviews for GOLGA5 Antibody (NBP1-83352) (0)

There are no reviews for GOLGA5 Antibody (NBP1-83352). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GOLGA5 Antibody (NBP1-83352) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GOLGA5 Products

Bioinformatics Tool for GOLGA5 Antibody (NBP1-83352)

Discover related pathways, diseases and genes to GOLGA5 Antibody (NBP1-83352). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GOLGA5 Antibody (NBP1-83352)

Discover more about diseases related to GOLGA5 Antibody (NBP1-83352).
 

Pathways for GOLGA5 Antibody (NBP1-83352)

View related products by pathway.

PTMs for GOLGA5 Antibody (NBP1-83352)

Learn more about PTMs related to GOLGA5 Antibody (NBP1-83352).
 

Research Areas for GOLGA5 Antibody (NBP1-83352)

Find related products by research area.

Blogs on GOLGA5

There are no specific blogs for GOLGA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GOLGA5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLGA5