GnRH Antibody

Images

 
Western Blot: GnRH Antibody [H00002796-B01P] - Analysis of GnRH expression in transfected 293T cell line by GNRH1 polyclonal antibody. Lane 1: GNRH1 transfected lysate(10.12 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GnRH Antibody Summary

Immunogen
GNRH1 (NP_000816.1, 1 a.a. - 92 a.a.) full-length human protein. MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GNRH1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GnRH Antibody

  • GNRH
  • GnRH-associated peptide 1
  • gonadotropin-releasing hormone 1 (leutinizing-releasing hormone)
  • gonadotropin-releasing hormone 1 (luteinizing-releasing hormone)
  • GRH
  • LHRH
  • LNRH
  • luliberin I
  • Progonadoliberin I
  • progonadoliberin-1
  • prolactin release-inhibiting factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC

Publications for GnRH Antibody (H00002796-B01P) (0)

There are no publications for GnRH Antibody (H00002796-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GnRH Antibody (H00002796-B01P) (0)

There are no reviews for GnRH Antibody (H00002796-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GnRH Antibody (H00002796-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GnRH Products

Bioinformatics Tool for GnRH Antibody (H00002796-B01P)

Discover related pathways, diseases and genes to GnRH Antibody (H00002796-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GnRH Antibody (H00002796-B01P)

Discover more about diseases related to GnRH Antibody (H00002796-B01P).
 

Pathways for GnRH Antibody (H00002796-B01P)

View related products by pathway.

PTMs for GnRH Antibody (H00002796-B01P)

Learn more about PTMs related to GnRH Antibody (H00002796-B01P).
 

Research Areas for GnRH Antibody (H00002796-B01P)

Find related products by research area.

Blogs on GnRH.

The Use of RNA Polymerase II Antibodies In Proteasome Regulation Studies
At Novus Biologicals, we recently added a new RNA Polymerase II antibody (clone 4H8) to our antibody catalog. RNAPII is an essential transcription enzyme, catalyzing the transcription of DNA during the elongation stage of mRNA synthesis (known as the...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GnRH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNRH1
Uniprot