GMCL1 Antibody - BSA Free

Western Blot: GMCL1 Antibody [NBP2-84991] - WB Suggested Anti-GMCL1 Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole CellGMCL1 is supported by BioGPS gene expression data to be expressed in HEK293T

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GMCL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GMCL1 Antibody - BSA Free (NBP2-84991) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GMCL1. Peptide sequence: QWFAMLRAEQDSEVGPQEINKEELEGNSMRCGRKLAKDGEYCWRWTGFNF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GMCL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GMCL1 Antibody - BSA Free

• BTBD13
• FLJ13057
• GCL
• GCL1
• germ cell-less homolog 1 (Drosophila)
• germ cell-less protein-like 1

Background

The GMCL1 gene encodes a nuclear envelope protein that appears to be involved in spermatogenesis, either directly or by influencing genes that play a more direct role in the process. This multi-exon locus is the homolog of the mouse and drosophila germ cell-le

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GMCL1