GM-CSF Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GM-CSF Antibody [NBP2-56096] - Staining of human cell line A-431 shows localization to vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GM-CSF Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PETSCATQIITFESFKENLKDFLLVIPFDCWEPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GM-CSF Recombinant Protein Antigen (NBP2-56096PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GM-CSF Antibody - BSA Free

• colony stimulating factor 2 (granulocyte-macrophage)
• Colony-stimulating factor
• CSF
• CSF2
• CSF-2
• GMCSF
• GM-CSF
• GMCSFgranulocyte-macrophage colony-stimulating factor
• granulocyte-macrophage colony stimulating factor
• MGC131935
• MGC138897
• Molgramostim
• molgramostin
• Sargramostim

Background

The cytokine GM-CSF stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. Used in myeloid reconstitution following bone marrow transplant, bone marrow transplant engraftment failure or delay, mobilization and following transplantation of autologous peripheral blood progenitor cells, and following induction chemotherapy in older adults with acute myelogenous leukemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSF2