GLYAT Antibody

Images

 
Western Blot: GLYAT Antibody [NBP1-54714] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Immunohistochemistry: GLYAT Antibody [NBP1-54714] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1:100 Other Working ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLYAT Antibody Summary

Immunogen
Synthetic peptides corresponding to GLYAT(glycine-N-acyltransferase) The peptide sequence was selected from the N terminal of GLYAT. Peptide sequence HYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLYAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against GLYAT and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GLYAT Antibody

  • ACGNATAAc
  • Acyl-CoA:glycine N-acyltransferase
  • Aralkyl acyl-CoA N-acyltransferase
  • Aralkyl acyl-CoA:amino acid N-acyltransferase
  • aralkyl-CoA N-acyltransferase
  • CATEC 2.3.1.13
  • GATHRP-1(CLP)
  • glycine N-acyltransferase
  • glycine-N-acyltransferase

Background

The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoA's.The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoA's. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16686
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NB100-1519
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NB110-61574
Species: Hu, Mu, Bv, Gt, Sh
Applications: WB
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-69571
Species: Mu
Applications: WB, IHC, IHC-P
NBP1-54714
Species: Hu
Applications: WB, IHC

Publications for GLYAT Antibody (NBP1-54714) (0)

There are no publications for GLYAT Antibody (NBP1-54714).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLYAT Antibody (NBP1-54714) (0)

There are no reviews for GLYAT Antibody (NBP1-54714). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLYAT Antibody (NBP1-54714) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GLYAT Products

Bioinformatics Tool for GLYAT Antibody (NBP1-54714)

Discover related pathways, diseases and genes to GLYAT Antibody (NBP1-54714). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLYAT Antibody (NBP1-54714)

Discover more about diseases related to GLYAT Antibody (NBP1-54714).
 

Pathways for GLYAT Antibody (NBP1-54714)

View related products by pathway.

PTMs for GLYAT Antibody (NBP1-54714)

Learn more about PTMs related to GLYAT Antibody (NBP1-54714).

Blogs on GLYAT

There are no specific blogs for GLYAT, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLYAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLYAT
Uniprot
Novus 100% Guarantee