![Western Blot: Glutathione Synthetase Antibody [NBP3-03702] - WB image submitted by a verified customer review.](http://images.novusbio.com/fullsize/Glutathione-Synthetase-Antibody-Western-Blot-NBP3-03702-img0003.jpg "Western Blot: Glutathione Synthetase Antibody [NBP3-03702] - WB image submitted by a verified customer review.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 373-474 of human Glutathione Synthetase (NP_000169.1). NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GSS |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Reviewed Applications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Hua Jiang |
WB | Mouse | 08/16/2021 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Glutathione Synthetase Antibody (NBP3-03702)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GSS |
![Western Blot: Glutathione Synthetase Antibody [NBP3-03702] - Analysis of extracts from normal (control) and GSS knockout (KO) 293T cells, using Glutathione Synthetase antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/Glutathione-Synthetase-Antibody-Knockout-Validated-NBP3-03702-img0001.jpg "Western Blot: Glutathione Synthetase Antibody [NBP3-03702] - Analysis of extracts from normal (control) and GSS knockout (KO) 293T cells, using Glutathione Synthetase antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.")
![Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] - Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Glutathione Synthetase Rabbit pAb (A14535) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-03702_rabbit-polyclonal-glutathione-synthetase-antibody-52202519313410.jpg "Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] - Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Glutathione Synthetase Rabbit pAb (A14535) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] - Immunofluorescence analysis of U2OS cells using [KO Validated] Glutathione Synthetase Rabbit pAb (A14535) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-03702_rabbit-polyclonal-glutathione-synthetase-antibody-52202519302977.jpg "Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] - Immunofluorescence analysis of U2OS cells using [KO Validated] Glutathione Synthetase Rabbit pAb (A14535) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] - Immunofluorescence analysis of PC-12 cells using [KO Validated] Glutathione Synthetase Rabbit pAb (A14535) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-03702_rabbit-polyclonal-glutathione-synthetase-antibody-5220251931397.jpg "Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] - Immunofluorescence analysis of PC-12 cells using [KO Validated] Glutathione Synthetase Rabbit pAb (A14535) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunocytochemistry/ Immunofluorescence c-jun [p Ser63] Antibody (SY0297)](https://images.novusbio.com/images/c-jun-p-Ser63-Antibody-SY0297-Immunocytochemistry-Immunofluorescence-NBP2-67471-img0001.jpg)
![Immunocytochemistry/ Immunofluorescence c-jun [p Ser63] Antibody (SY0297)](https://images.novusbio.com/images/c-jun-p-Ser63-Antibody-SY0297-Immunocytochemistry-Immunofluorescence-NBP2-67471-img0002.jpg)
![Immunohistochemistry-Paraffin c-jun [p Ser63] Antibody (SY0297)](https://images.novusbio.com/images/c-jun-p-Ser63-Antibody-SY0297-Immunohistochemistry-Paraffin-NBP2-67471-img0003.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
