Glutathione Synthetase Antibody

Images

 
Western Blot: Glutathione Synthetase Antibody [NBP2-30465] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody [NBP2-30465] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glutathione Synthetase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glutathione Synthetase Protein (NBP2-30465PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glutathione Synthetase Antibody

  • EC 6.3.2.3
  • Glutathione synthase
  • glutathione synthetase
  • GSH synthetase
  • GSHS
  • GSH-S
  • MGC14098

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56605
Species: Av, Bv, Sh
Applications: WB
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00079092-T01
Species: Hu
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-56928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-43705
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-49118
Species: Hu
Applications: IHC, IHC-P

Publications for Glutathione Synthetase Antibody (NBP2-30465) (0)

There are no publications for Glutathione Synthetase Antibody (NBP2-30465).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutathione Synthetase Antibody (NBP2-30465) (0)

There are no reviews for Glutathione Synthetase Antibody (NBP2-30465). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glutathione Synthetase Antibody (NBP2-30465) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glutathione Synthetase Products

Bioinformatics Tool for Glutathione Synthetase Antibody (NBP2-30465)

Discover related pathways, diseases and genes to Glutathione Synthetase Antibody (NBP2-30465). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutathione Synthetase Antibody (NBP2-30465)

Discover more about diseases related to Glutathione Synthetase Antibody (NBP2-30465).
 

Pathways for Glutathione Synthetase Antibody (NBP2-30465)

View related products by pathway.

PTMs for Glutathione Synthetase Antibody (NBP2-30465)

Learn more about PTMs related to Glutathione Synthetase Antibody (NBP2-30465).
 

Research Areas for Glutathione Synthetase Antibody (NBP2-30465)

Find related products by research area.

Blogs on Glutathione Synthetase

There are no specific blogs for Glutathione Synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutathione Synthetase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSS
Uniprot