Glutathione Reductase Antibody

Images

 
Immunohistochemistry: Glutathione Reductase Antibody [NBP1-88118] - Staining of human epididymis shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glutathione Reductase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Glutathione Reductase Recombinant Protein Antigen (NBP1-88118PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glutathione Reductase Antibody

  • EC 1.8.1
  • EC 1.8.1.7
  • GLUR
  • Glutathione Reductase
  • glutathione reductase, mitochondrial
  • GR
  • GRase
  • GRD1
  • GSR
  • HEL-752
  • MGC78522

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB300-562
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
NB110-61574
Species: Bv, Gt, Hu, Mu, Sh
Applications: WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
7570-GH
Species: Hu
Applications: EnzAct
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-88118
Species: Hu
Applications: IHC, IHC-P

Publications for Glutathione Reductase Antibody (NBP1-88118) (0)

There are no publications for Glutathione Reductase Antibody (NBP1-88118).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutathione Reductase Antibody (NBP1-88118) (0)

There are no reviews for Glutathione Reductase Antibody (NBP1-88118). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Glutathione Reductase Antibody (NBP1-88118) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glutathione Reductase Products

Bioinformatics Tool for Glutathione Reductase Antibody (NBP1-88118)

Discover related pathways, diseases and genes to Glutathione Reductase Antibody (NBP1-88118). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutathione Reductase Antibody (NBP1-88118)

Discover more about diseases related to Glutathione Reductase Antibody (NBP1-88118).
 

Pathways for Glutathione Reductase Antibody (NBP1-88118)

View related products by pathway.

PTMs for Glutathione Reductase Antibody (NBP1-88118)

Learn more about PTMs related to Glutathione Reductase Antibody (NBP1-88118).
 

Research Areas for Glutathione Reductase Antibody (NBP1-88118)

Find related products by research area.

Blogs on Glutathione Reductase

There are no specific blogs for Glutathione Reductase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutathione Reductase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSR