Glutamate Dehydrogenase Antibody

Images

 
Western Blot: Glutamate Dehydrogenase Antibody [NBP2-57114] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: Glutamate Dehydrogenase Antibody [NBP2-57114] - Staining of human cell line U-2 OS shows localization to mitochondria.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glutamate Dehydrogenase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDK
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLUD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glutamate Dehydrogenase Recombinant Protein Antigen (NBP2-57114PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Glutamate Dehydrogenase Antibody

  • EC 1.4.1
  • EC 1.4.1.3
  • GDH 1
  • GDH
  • GDH1
  • GLUD
  • glutamate dehydrogenase (NAD(P)+)
  • Glutamate Dehydrogenase 1
  • glutamate dehydrogenase 1, mitochondrial
  • MGC132003

Background

One enzyme central to the metabolism of glutamate is glutamate dehydrogenase (GDH1; EC 1.4.1.3), that catalyzes the reversible deamination of L-glutamate to 2-oxoglutarate using NAD+ or NADP+. Mammalian GDH is composed of six identical subunits, and the regulation of GDH is very complex. It has been a major goal to identify the substrate and regulatory binding sites of GDH. It is only in recent years that the three-dimensional structure of GDH from microorganisms is available. Very recently, crystallization of bovine liver GDH was reported for the first time from the mammalian sources. However, remarkably little is known about the detailed structure of mammalian GDH, especially the brain enzymes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glutamate Dehydrogenase Antibody (NBP2-57114) (0)

There are no publications for Glutamate Dehydrogenase Antibody (NBP2-57114).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutamate Dehydrogenase Antibody (NBP2-57114) (0)

There are no reviews for Glutamate Dehydrogenase Antibody (NBP2-57114). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glutamate Dehydrogenase Antibody (NBP2-57114) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glutamate Dehydrogenase Products

Research Areas for Glutamate Dehydrogenase Antibody (NBP2-57114)

Find related products by research area.

Blogs on Glutamate Dehydrogenase

There are no specific blogs for Glutamate Dehydrogenase, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutamate Dehydrogenase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLUD1