Glut3 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human Glut3 (NP_008862). Peptide sequence RQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNT |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC2A3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
54 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Glut3 Antibody - BSA Free
Background
Glucose is the major source of our energy and there are numerous isoforms of the glucose transporter in mammals, including Glut1, Glut2, Glut3, Glut4, Glut5, Glut6, Glut7, Glut8 and Glut9. The Glut5 gene located on the short arm of human chromosome 1 encodes a 501-amino acid facilitative glucose transporter. Glut5 mRNA is highly expressed in small intestine and to a lesser extent in kidney, skeletal muscle and adipose tissue. Glut5 plays a critical role in fructose absorption in the small intestine and its expression is highly induced when exposed to a fructose-enriched diet. Glut5 transporter expressed in human skeletal muscle is specifically localized to the plasma membrane, where it participates in regulating hexose transfer across the sarcolemma. Glut8, a novel glucose transporter-like protein, exhibits significant sequence similarity with the other members of sugar transporter family. Glut8 comprises 12 putative membrane-spanning helices and several conserved motifs, which are important for transport activity. In human tissues, Glut8 is predominantly expressed in testis and, to a lesser extent, in most other tissues including skeletal muscle, heart, small intestine and brain. In addition, the Glut8 glucose transport facilitator has a hormonally regulated testicular function.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Publications for Glut3 Antibody (NBP3-09953) (0)
There are no publications for Glut3 Antibody (NBP3-09953).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glut3 Antibody (NBP3-09953) (0)
There are no reviews for Glut3 Antibody (NBP3-09953).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Glut3 Antibody (NBP3-09953) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glut3 Products
Research Areas for Glut3 Antibody (NBP3-09953)
Find related products by research area.
|
Blogs on Glut3