| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ELISA, ICC/IF, IHC |
| Clone | 10O1I5 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit Glut1 Antibody (10O1I5) (NBP3-15433) is a recombinant monoclonal antibody validated for use in IHC, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 393-492 of human Glut1 (P11166). ELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | SLC2A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 54 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Glut1 Antibody (NBP3-15433)Find related products by research area.
|
|
Deficiency of GluT1 leads to neurological problems while excess is involved in cancers By Jamshed Arslan, Pharm. D., PhD. What Are GluTs?Mammalian cell metabolism is incomplete without glucose . Glucose is a monosaccharide that is transported to the cells through facilitative diffusion, a ... Read full blog post. |
|
Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysis By Rosa Moreno, PhD. Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysisPhysiological low levels of oxygen induce normal hypoxic events across biological systems. This hypoxic state activ... Read full blog post. |
|
Forecasting and Targeting a Rare Cancer with Hypoxia-Inducible Factor By Jamshed Arslan Pharm.D. Cancers of nerve, adipose, and other soft tissues are called soft tissue sarcomas (STS). Malignant peripheral nerve sheath tumor (MPNST) is an example of a rare and hard-to-treat STS; eve... Read full blog post. |
|
HIF-2 alpha: HIF1A's Homologue with Similar and Divergent Functions HIF-2 alpha is a member of the heterodimeric hypoxia-inducible factors/HIFs family (HIF-1, HIF-2, and HIF-3) which contains a common beta subunit but differ in their alpha subunits. Also called as EPAS1 or Mop2, HIF-2 alpha regulates cellular adapt... Read full blog post. |
|
Glucose Transporter 1 (GLUT1): a Key Metabolic Neuronal Player Glucose is the principal fuel source for the brain and GLUT1 is the only vehicle by which glucose enters the brain. In case of GLUT1 deficiency, the risk of clinical manifestations is increased in infancy and childhood, when the brain glucose demand i... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC2A1 |