Glut1 Antibody (10O1I5)

Images

 
IHC-P- Glut1 Antibody (10O1I5) [NBP3-15433] - Analysis of GLUT1/SLC2A1 in paraffin-embedded human cervix cancer tissue using GLUT1/SLC2A1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was ...read more
IHC-P- Glut1 Antibody (10O1I5) [NBP3-15433] - Analysis of GLUT1/SLC2A1 in paraffin-embedded human liver tissue using GLUT1/SLC2A1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was ...read more
IHC-P- Glut1 Antibody (10O1I5) [NBP3-15433] - Mouse liver tissue using GLUT1/SLC2A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used ...read more
IHC-P- Glut1 Antibody (10O1I5) [NBP3-15433] -Human pancreas tissue using GLUT1/SLC2A1 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to ...read more
IHC-P- Glut1 Antibody (10O1I5) [NBP3-15433] -Human placenta tissue using GLUT1/SLC2A1 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to ...read more
Immunohistochemistry: Glut1 Antibody (10O1I5) [Glut1] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Glut1 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval ...read more
Immunohistochemistry: Glut1 Antibody (10O1I5) [Glut1] - Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using Glut1 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure ...read more
Immunocytochemistry/ Immunofluorescence: Glut1 Antibody (10O1I5) [Glut1] - Confocal imaging of paraffin-embedded Human prostate cancer tissue using Glut1 Rabbit mAb followed by a further incubation with Cy3 Goat ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ELISA, ICC/IF, IHC
Clone
10O1I5
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glut1 Antibody (10O1I5) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 393-492 of human Glut1 (P11166). ELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
SLC2A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Glut1 Antibody (10O1I5)

  • Choreoathetosis/Spasticity, Episodic (Paroxysmal Choreoathetosis)
  • CSE
  • DYT17
  • DYT18
  • DYT9
  • EIG12
  • Glucose transporter type 1, erythrocyte/brain
  • Glut1
  • GLUT-1
  • GLUT1DS
  • HepG2 glucose transporter
  • HTLVR
  • Human T-Cell Leukemia Virus (I and II) Receptor
  • MGC141895
  • MGC141896
  • PED
  • SLC2A1
  • solute carrier family 2 (facilitated glucose transporter), member 1
  • Solute Carrier Family 2 Member 1
  • solute carrier family 2, facilitated glucose transporter member 1

Background

Glucose transporter 1 (GLUT1) or solute carrier family 2 (SLC2A1) is a member of the GLUT family of monosaccharides and polyols transporters. GLUT proteins transport glucose across cellular membranes through facilitative mechanisms and play a key role in glucose homeostasis (1). Fourteen GLUT proteins have been identified in the human, which are encoded by SLC2A genes 1-14 and are broadly expressed in many cell types and tissues. GLUT family members differ in sequence homology, substrate specificity and expression patterns. Based on sequence homology, GLUT family members are classified into Class I (GLUT1, 2, 3, 4, and GLUT14), Class II (GLUT5, 7, 9, and 11), and Class III (GLUT6, 8, 10, 12 and 13) (1). Structurally, GLUT transporters are integral membrane glycoproteins consisting of 12 membrane spanning helical domains, a single N-linked glycosylation site, and having cytoplasmic facing carboxy and amino terminal domains (2).

GLUT1 (Human glycosylated form theoretical molecular weight 55kDa) functions primarily as a glucose transporter but can transport other substrates including mannose, galactose and glucosamine across the membrane (3). Like other GLUT family members, GLUT1 is broadly expressed, nevertheless it is the predominant glucose transporter expressed in red blood cells and brain endothelial cells (1). SLC2A1 mutations underscore the autosomal dominant disorder GLUT1 deficiency syndrome (GLUTI-DS) which is characterized by low glucose levels in the brain or hypoglycorrhachia due to insufficient glucose transport across the blood brain barrier (2, 4, 5). Phenotypically, GLUT1-DS is characterized by early onset seizures, neurologic developmental delay, microcephaly, and ataxia (4). GLUT1 is highly expressed in the endothelium of cutaneous vascular lesions and serves as a marker for the diagnosis of juvenile or infantile hemangiomas (6).

References

1. Augustin, R. (2010). The protein family of glucose transport facilitators: It's not only about glucose after all. IUBMB Life. https://doi.org/10.1002/iub.315

2. Mueckler, M., & Thorens, B. (2013). The SLC2 (GLUT) family of membrane transporters. Molecular Aspects of Medicine. https://doi.org/10.1016/j.mam.2012.07.001

3. Stein, W. D., & Litman, T. (2015). Carrier-Mediated Transport. In Channels, Carriers, and Pumps. https://doi.org/10.1016/b978-0-12-416579-3.00004-6

4. Pearson, T. S., Akman, C., Hinton, V. J., Engelstad, K., & De Vivo, D. C. (2013). Phenotypic spectrum of glucose transporter type 1 deficiency syndrome (Glut1 DS). Current Neurology and Neuroscience Reports. https://doi.org/10.1007/s11910-013-0342-7

5. Messana, T., Russo, A., Vergaro, R., Boni, A., Santucci, M., & Pini, A. (2018). Glucose transporter type 1 deficiency syndrome: Developmental delay and early-onset ataxia in a novel mutation of the SLC2A1 gene. Journal of Pediatric Neurosciences. https://doi.org/10.4103/JPN.JPN_169_17

6. van Vugt, L. J., van der Vleuten, C. J. M., Flucke, U., & Blokx, W. A. M. (2017). The utility of GLUT1 as a diagnostic marker in cutaneous vascular anomalies: A review of literature and recommendations for daily practice. Pathology Research and Practice. https://doi.org/10.1016/j.prp.2017.04.023

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
MAB1415
Species: Hu
Applications: CyTOF-ready, Flow, ICC
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DVE00
Species: Hu
Applications: ELISA
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
NBP2-22218
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-12793
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
291-G1
Species: Hu
Applications: BA
NB100-82001
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NB100-417
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, MiAr, PLA, Simple Western, WB
NBP1-47980
Species: Hu, Pm
Applications: Flow, IHC,  IHC-P, IP, WB
MAB8164
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
NBP2-20216
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-81328
Species: Hu
Applications: ICC/IF, WB
NBP2-20338
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-12263
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF,  IHC-P, IP, WB
NBP3-03807
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP3-15433
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC

Publications for Glut1 Antibody (NBP3-15433) (0)

There are no publications for Glut1 Antibody (NBP3-15433).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glut1 Antibody (NBP3-15433) (0)

There are no reviews for Glut1 Antibody (NBP3-15433). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Glut1 Antibody (NBP3-15433) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glut1 Products

Research Areas for Glut1 Antibody (NBP3-15433)

Find related products by research area.

Blogs on Glut1.

Deficiency of GluT1 leads to neurological problems while excess is involved in cancers
By Jamshed Arslan, Pharm. D., PhD. What Are GluTs?Mammalian cell metabolism is incomplete without glucose   . Glucose is a monosaccharide that is transported to the cells through facilitative diffusion, a ...  Read full blog post.

Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysis
By Rosa Moreno, PhD. Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysisPhysiological low levels of oxygen induce normal hypoxic events across biological systems. This hypoxic state activ...  Read full blog post.

Forecasting and Targeting a Rare Cancer with Hypoxia-Inducible Factor
By Jamshed Arslan Pharm.D. Cancers of nerve, adipose, and other soft tissues are called soft tissue sarcomas (STS). Malignant peripheral nerve sheath tumor (MPNST) is an example of a rare and hard-to-treat STS; eve...  Read full blog post.

HIF-2 alpha: HIF1A's Homologue with Similar and Divergent Functions
HIF-2 alpha is a member of the heterodimeric hypoxia-inducible factors/HIFs family (HIF-1, HIF-2, and HIF-3) which contains a common beta subunit but differ in their alpha subunits. Also called as EPAS1 or Mop2, HIF-2 alpha regulates cellular adapt...  Read full blog post.

Glucose Transporter 1 (GLUT1): a Key Metabolic Neuronal Player
Glucose is the principal fuel source for the brain and GLUT1 is the only vehicle by which glucose enters the brain. In case of GLUT1 deficiency, the risk of clinical manifestations is increased in infancy and childhood, when the brain glucose demand i...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glut1 Antibody (10O1I5) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC2A1