GluR2 Antibody (9R1X2)

Images

 
Western Blot: GluR2 Antibody (9R1X2) [NBP3-15370] - Analysis of extracts of various cell lines, using GluR2 Rabbit mAb (NBP3-15370) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunocytochemistry/ Immunofluorescence: GluR2 Antibody (9R1X2) [NBP3-15370] - Immunofluorescence analysis of SH-SY5Y cells using GluR2 Rabbit mAb (NBP3-15370) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear ...read more
Immunohistochemistry: GluR2 Antibody (9R1X2) [NBP3-15370] - Immunofluorescence analysis of mouse brain using GluR2 Rabbit mAb (NBP3-15370) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: GluR2 Antibody (9R1X2) [NBP3-15370] - Rat brain using GluR2 Rabbit mAb (NBP3-15370) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before ...read more
Immunohistochemistry-Paraffin: GluR2 Antibody (9R1X2) [NBP3-15370] - Mouse brain using GluR2 Rabbit mAb (NBP3-15370) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 ...read more
Immunohistochemistry: GluR2 Antibody (9R1X2) [NBP3-15370] - Immunofluorescence analysis of rat brain using GluR2 Rabbit mAb (NBP3-15370) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
9R1X2
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GluR2 Antibody (9R1X2) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GluR2 (P42262). YLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKI
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
GRIA2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GluR2 Antibody (9R1X2)

  • AMPA 2
  • AMPA2
  • GluA2
  • GluR2
  • GLURB
  • GluR-K2
  • glutamate receptor, ionotropic, AMPA 2
  • GRIA2
  • HBGR2

Background

The GRIA2 gene encodes for glutamate receptor 2 with an isoform flop of 883 amino acids, 98 kDA, isoform flip of 883 amino acids and 98 kDA, and an isoform 3 of 901 amino acids long and 100 kDA. Glutamate receptors function as a ligand-gated ion channel in the central nervous system and are the predominant excitatory neurotransmitter receptors in the brain. GRIA2 has been researched regarding its role in Alzheimer's disease, multiple sclerosis, motor neuron disease, epilepsy, anorexia, bioplar disorder, and neurodegeneration. GRIA2 is involved in the CREB pathway, intracellular calcium signaling, glutamic acid signaling, and calcium channels as well as interacts with genes NSF, GRIA3, DLG4, GRID2, and SDCBP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GluR2 Antibody (NBP3-15370) (0)

There are no publications for GluR2 Antibody (NBP3-15370).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GluR2 Antibody (NBP3-15370) (0)

There are no reviews for GluR2 Antibody (NBP3-15370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GluR2 Antibody (NBP3-15370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GluR2 Products

Array NBP3-15370

Research Areas for GluR2 Antibody (NBP3-15370)

Find related products by research area.

Blogs on GluR2

There are no specific blogs for GluR2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GluR2 Antibody (9R1X2) and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIA2