![Immunocytochemistry/Immunofluorescence: Glucuronic Acid Epimerase Antibody [NBP2-31985] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Glucuronic-Acid-Epimerase-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31985-img0011.jpg "Immunocytochemistry/Immunofluorescence: Glucuronic Acid Epimerase Antibody [NBP2-31985] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.")
| Reactivity | Hu, Eq, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Glucuronic Acid Epimerase Antibody - BSA Free (NBP2-31985) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Glucuronic Acid Epimerase Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQYDGYDR |
| Predicted Species | Mouse (93%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GLCE |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
![Simple Western Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF1060_Simple_Western_18969.jpg)
![Western Blot Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF1060_Western_Blot_19006.jpg)
![Immunohistochemistry Decorin Antibody [Unconjugated]](https://images.novusbio.com/images/af1060_mouse-decorin-affinity-purified-polyclonal-ab-8120255552891.jpg)
| Publication using NBP2-31985 | Applications | Species |
|---|---|---|
| Young M, Moshood O, Zhang J et al. Does BMP2 play a role in the pathogenesis of equine degenerative suspensory ligament desmitis. BMC Res Notes 2018-09-18 [PMID: 30227887] (IHC-P, Equine) | IHC-P | Equine |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Glucuronic Acid Epimerase Antibody [NBP2-31985] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/Glucuronic-Acid-Epimerase-Antibody-Immunohistochemistry-Paraffin-NBP2-31985-img0010.jpg "Immunohistochemistry-Paraffin: Glucuronic Acid Epimerase Antibody [NBP2-31985] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.")
![Flow Cytometry Syndecan-2/CD362 Antibody (305515) [Unconjugated]](https://images.novusbio.com/images2/Syndecan2_MAB2965_Flow_Cytometry_20268.jpg)
![Immunohistochemistry Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Endorepellin_AF2364_Immunohistochemistry_6744.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![N/A APRIL/TNFSF13 [Biotin]](https://images.novusbio.com/images2/DATA_APRIL_DY884_ELISA_2333.jpg)
![N/A APRIL/TNFSF13 [Biotin]](https://images.novusbio.com/images2/DATA_APRIL_DY884_ELISA_2253.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")