New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Glucuronic Acid Epimerase Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Glucuronic Acid Epimerase Antibody [NBP2-31985] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Glucuronic Acid Epimerase Antibody [NBP2-31985] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Eq, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glucuronic Acid Epimerase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQYDGYDR
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLCE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glucuronic Acid Epimerase Protein (NBP2-31985PEP)
Publications
Read Publication using
NBP2-31985 in the following applications:

Reactivity Notes

Equine reactivity reported in the literature (PMID: 30227887).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glucuronic Acid Epimerase Antibody

  • D-glucuronyl C5-epimerase
  • EC 5.1.3
  • EC 5.1.3.-
  • glucuronic acid epimerase
  • glucuronyl C5-epimerase
  • Heparin/heparan sulfate:glucuronic acid C5-epimerase
  • HSEPIheparin/heparan sulfate-glucuronic acid C5-epimerase
  • KIAA0836heparan sulfate epimerase
  • UDP-glucuronic acid epimerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67618
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF6585
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-91982
Species: Hu
Applications: IHC, IHC-P, WB
AF2364
Species: Hu
Applications: IHC, WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP
AF143
Species: Hu
Applications: IHC, Simple Western, WB
7754-BH/CF
Species: Hu
Applications: BA
H00006275-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
DY884B
Species: Hu
Applications: ELISA
233-FB/CF
Species: Hu
Applications: BA
H00006925-M03
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-52533
Species: Bv, Ca, Hu, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-16394
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33208
Species: Hu
Applications: ICC/IF, WB
6514-SL
Species: Hu
Applications: BA
MAB3629
Species: Mu
Applications: IHC
973-TM
Species: Hu
Applications: InhibAct
NBP2-31985
Species: Hu, Eq, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Glucuronic Acid Epimerase Antibody (NBP2-31985)(1)

We have publications tested in 1 confirmed species: Equine.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Equine
(1)
All Species

Reviews for Glucuronic Acid Epimerase Antibody (NBP2-31985) (0)

There are no reviews for Glucuronic Acid Epimerase Antibody (NBP2-31985). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Glucuronic Acid Epimerase Antibody (NBP2-31985) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glucuronic Acid Epimerase Products

Bioinformatics Tool for Glucuronic Acid Epimerase Antibody (NBP2-31985)

Discover related pathways, diseases and genes to Glucuronic Acid Epimerase Antibody (NBP2-31985). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucuronic Acid Epimerase Antibody (NBP2-31985)

Discover more about diseases related to Glucuronic Acid Epimerase Antibody (NBP2-31985).
 

Pathways for Glucuronic Acid Epimerase Antibody (NBP2-31985)

View related products by pathway.

PTMs for Glucuronic Acid Epimerase Antibody (NBP2-31985)

Learn more about PTMs related to Glucuronic Acid Epimerase Antibody (NBP2-31985).

Blogs on Glucuronic Acid Epimerase

There are no specific blogs for Glucuronic Acid Epimerase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glucuronic Acid Epimerase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLCE
Uniprot