Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody

Images

 
There are currently no images for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-69352).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody Summary

Immunogen
Synthetic peptides corresponding to GNS(glucosamine (N-acetyl)-6-sulfatase (Sanfilippo disease IIID)) The peptide sequence was selected from the C terminal of GNS. Peptide sequence PILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against GNS and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody

  • EC 3.1.6
  • EC 3.1.6.14
  • G6Sglucosamine-6-sulfatase
  • glucosamine (N-acetyl)-6-sulfatase
  • Glucosamine6Sulfatase
  • Glucosamine-6-Sulfatase
  • GNS
  • MGC21274
  • N-acetylglucosamine-6-sulfatase

Background

GNS is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparin sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder ucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome.The product of this gene is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparan sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder mucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
MAB4415
Species: Hu
Applications: WB, ICC
H00347527-B01P
Species: Hu
Applications: WB, ELISA
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
AF3159
Species: Mu
Applications: WB, IHC
NBP1-57033
Species: Hu
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-12902
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-16610
Species: Hu
Applications: WB
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA

Publications for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-69352) (0)

There are no publications for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-69352).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-69352) (0)

There are no reviews for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-69352). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-69352) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glucosamine (N-acetyl)-6-Sulfatase/GNS Products

Bioinformatics Tool for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-69352)

Discover related pathways, diseases and genes to Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-69352). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-69352)

Discover more about diseases related to Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-69352).
 

Pathways for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-69352)

View related products by pathway.

PTMs for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-69352)

Learn more about PTMs related to Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-69352).

Blogs on Glucosamine (N-acetyl)-6-Sulfatase/GNS

There are no specific blogs for Glucosamine (N-acetyl)-6-Sulfatase/GNS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNS
Entrez
Uniprot