Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to Gns (glucosamine (N-acetyl)-6-sulfatase) The peptide sequence was selected from the C terminal of Gns.
Peptide sequence YIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLV. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GNS |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
58 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody - BSA Free
Background
GNS is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparin sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder ucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo, RIA, WB
Species: Hu
Applications: BA
Publications for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-68917) (0)
There are no publications for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-68917).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-68917) (0)
There are no reviews for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-68917).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody (NBP1-68917) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glucosamine (N-acetyl)-6-Sulfatase/GNS Products
Blogs on Glucosamine (N-acetyl)-6-Sulfatase/GNS