GHITM Antibody


Immunocytochemistry/ Immunofluorescence: GHITM Antibody [NBP2-49344] - Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
Immunohistochemistry-Paraffin: GHITM Antibody [NBP2-49344] - Staining of human kidney shows moderate cytoplasmic positivity in renal tubules.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

GHITM Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: TKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRW
Specificity of human GHITM antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GHITM Recombinant Protein Antigen (NBP2-49344PEP)

Reactivity Notes

Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GHITM Antibody

  • Dermal papilla-derived protein 2
  • DKFZp566C0746
  • FLJ26584
  • growth hormone inducible transmembrane protein
  • growth hormone-inducible transmembrane protein
  • HSPC282
  • Mitochondrial morphology and cristae structure 1
  • PTD010
  • TMBIM5My021
  • transmembrane BAX inhibitor motif containing 5
  • Transmembrane BAX inhibitor motif-containing protein 5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu, Mu, Rt, Ca, Eq, Mk, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for GHITM Antibody (NBP2-49344) (0)

There are no publications for GHITM Antibody (NBP2-49344).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GHITM Antibody (NBP2-49344) (0)

There are no reviews for GHITM Antibody (NBP2-49344). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GHITM Antibody (NBP2-49344) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for GHITM Antibody (NBP2-49344)

Discover related pathways, diseases and genes to GHITM Antibody (NBP2-49344). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GHITM Antibody (NBP2-49344)

Discover more about diseases related to GHITM Antibody (NBP2-49344).

Pathways for GHITM Antibody (NBP2-49344)

View related products by pathway.

PTMs for GHITM Antibody (NBP2-49344)

Learn more about PTMs related to GHITM Antibody (NBP2-49344).

Blogs on GHITM

There are no specific blogs for GHITM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GHITM Antibody and receive a gift card or discount.


Gene Symbol GHITM