GFR alpha-2/GDNF R alpha-2 Antibody


Western Blot: GDNF Receptor alpha 2 Antibody [NBP1-89778] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate more
Immunohistochemistry-Paraffin: GDNF Receptor alpha 2 Antibody [NBP1-89778] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GFR alpha-2/GDNF R alpha-2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GFR alpha-2/GDNF R alpha-2 Protein (NBP1-89778PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GFR alpha-2/GDNF R alpha-2 Antibody

  • GDNF family receptor alpha 2
  • GDNF family receptor alpha-2
  • GDNF R alpha-2
  • GDNF receptor alpha-2
  • GDNF receptor beta
  • GDNFR-alpha-2
  • GDNFR-beta
  • GDNFRBRET ligand 2
  • GFR alpha2
  • GFR alpha-2
  • GFRA2
  • GFRa-2
  • GFR-alpha 2
  • GFR-alpha-2
  • glial cell line derived neurotrophic factor receptor, beta
  • Neurturin receptor alpha
  • NRTNR-alpha
  • NTNR-alpha
  • PI-linked cell-surface accessory protein
  • RETL2TGF-beta-related neurotrophic factor receptor 2
  • TGF-beta related neurotrophic factor receptor 2
  • TRN receptor, GPI-anchored


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, Block
Species: Mu
Applications: WB, IHC
Species: Mu
Applications: WB, IHC, Neut
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for GFR alpha-2/GDNF R alpha-2 Antibody (NBP1-89778) (0)

There are no publications for GFR alpha-2/GDNF R alpha-2 Antibody (NBP1-89778).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFR alpha-2/GDNF R alpha-2 Antibody (NBP1-89778) (0)

There are no reviews for GFR alpha-2/GDNF R alpha-2 Antibody (NBP1-89778). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GFR alpha-2/GDNF R alpha-2 Antibody (NBP1-89778) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GFR alpha-2/GDNF R alpha-2 Products

Bioinformatics Tool for GFR alpha-2/GDNF R alpha-2 Antibody (NBP1-89778)

Discover related pathways, diseases and genes to GFR alpha-2/GDNF R alpha-2 Antibody (NBP1-89778). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GFR alpha-2/GDNF R alpha-2 Antibody (NBP1-89778)

Discover more about diseases related to GFR alpha-2/GDNF R alpha-2 Antibody (NBP1-89778).

Pathways for GFR alpha-2/GDNF R alpha-2 Antibody (NBP1-89778)

View related products by pathway.

PTMs for GFR alpha-2/GDNF R alpha-2 Antibody (NBP1-89778)

Learn more about PTMs related to GFR alpha-2/GDNF R alpha-2 Antibody (NBP1-89778).

Blogs on GFR alpha-2/GDNF R alpha-2

There are no specific blogs for GFR alpha-2/GDNF R alpha-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GFR alpha-2/GDNF R alpha-2 Antibody and receive a gift card or discount.


Gene Symbol GFRA2