GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-89778] - Analysis in human thyroid gland tissue.

Immunohistochemistry-Paraffin: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-89778] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR
• Predicted Species: Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GFRA2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GFR alpha-2/GDNF R alpha-2 Protein (NBP1-89778PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

• GDNF family receptor alpha 2
• GDNF family receptor alpha-2
• GDNF R alpha-2
• GDNF receptor alpha-2
• GDNF receptor beta
• GDNFR-alpha-2
• GDNFR-beta
• GDNFRBRET ligand 2
• GFR alpha2
• GFR alpha-2
• GFRA2
• GFRa-2
• GFR-alpha 2
• GFR-alpha-2
• glial cell line derived neurotrophic factor receptor, beta
• Neurturin receptor alpha
• NRTNR-alpha
• NTNRA
• NTNR-alpha
• PI-linked cell-surface accessory protein
• RETL2TGF-beta-related neurotrophic factor receptor 2
• TGF-beta related neurotrophic factor receptor 2
• TRN receptor, GPI-anchored
• TRNR2NRTNR-ALPHA

Background

Members of the glial cell line derived neurotrophic factor (GDNF) family, including GDNF and neurturin (NTN), play key roles in the control of vertebrate neuron survival and differentiation. Physiological responses to NTN require the presence of a novel glycosylphosphadidylinositol linked protein NTNRa, which is a cell surface receptor for NTN. The cDNAs encoding NTNRa from human, rat, chicken, and mouse have been cloned recently. NTNRa was also termed GDNFRb, Ret ligand 2 (RETL2) or TGFb related neurotrophic factor receptor 2 (TrnR2) and nominated as GFRa2 recently. GFRa2 binds NTN and mediates activation of RET receptor tyrosine kinase by both NTN and GDNF. Thus, NTN, GFRa2, and the Ret PTK form a complex to transduce NTN signal and to mediate NTN function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GFRA2