GFR alpha-1/GDNF R alpha-1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GFRA1. Source: E. coli
Amino Acid Sequence: IGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
GFRA1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14045. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for GFR alpha-1/GDNF R alpha-1 Recombinant Protein Antigen
Background
Glial cell line-derived neurotrophic factor (GDNF) is a potent survival factor for central and peripheral neurons and is essential for the development of kidneys and the enteric nerves system. Physiological responses to GDNF require the presence of a novel glycosylphosphadidylinositol linked protein GDNFRalpha, which is a cell surface receptor for GDNF (1,2). The cDNAs encoding GDNFRalpha from human, rat, chicken and mouse have been cloned recently (1-5). GDNFRalpha was also termed Ret ligand 1 (RETL1) or TGF-beta-related neurotrophic factor receptor 1 (TrnR1) and nominated as GFRalpha-1 recently (5-7). GFRalpha-1 binds GDNF specifically and mediates activation of the Ret protein tyrosine kinase (PTK). Thus, GDNF, GFRalpha and the Ret PTK form a complex to transduce GDNF signal and to mediate GDNF function.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Bind, BA
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: Bind, BA
Species: Hu, Mu
Applications: Block, ICC, IHC, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: BA, PAGE
Species: Hu
Applications: Neut, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Rt
Applications: IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for GFR alpha-1/GDNF R alpha-1 Protein (NBP2-14045PEP) (0)
There are no publications for GFR alpha-1/GDNF R alpha-1 Protein (NBP2-14045PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GFR alpha-1/GDNF R alpha-1 Protein (NBP2-14045PEP) (0)
There are no reviews for GFR alpha-1/GDNF R alpha-1 Protein (NBP2-14045PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GFR alpha-1/GDNF R alpha-1 Protein (NBP2-14045PEP) (0)
Additional GFR alpha-1/GDNF R alpha-1 Products
Research Areas for GFR alpha-1/GDNF R alpha-1 Protein (NBP2-14045PEP)
Find related products by research area.
|
Blogs on GFR alpha-1/GDNF R alpha-1