GDF-15 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GDF-15 Antibody [NBP2-68911] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GDF-15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GDF-15 Antibody - BSA Free (NBP2-68911) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GDF15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  GDF-15 Recombinant Protein Antigen (NBP2-68911PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GDF-15 Antibody - BSA Free

• GDF15
• GDF-15
• growth differentiation factor 15
• growth/differentiation factor 15
• Macrophage inhibitory cytokine 1
• MIC-1
• MIC-1NSAID-activated gene 1 protein
• MIC1Prostate differentiation factor
• NAG-1
• NAG-1NSAID-regulated gene 1 protein
• NSAID (nonsteroidal inflammatory drug)-activated protein 1
• PDF
• PDFGDF-15
• PLAB
• PLABNRG-1
• Placental bone morphogenetic protein
• Placental TGF-beta
• PTGF-beta
• PTGFBPTGF-beta

Background

Growth differentiation factor 15 (GDF15) is a transforming growth factor beta superfamily member that acts to regulate inflammatory and apoptotic responses in injured or diseased tissues. GDF15 is most strongly expressed in the liver, placenta and kidney.

GDF15 antibodies are useful for studies on inflamation and immune system research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GDF15