GCSH Antibody

Images

 
Western Blot: GCSH Antibody [NBP1-85842] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunocytochemistry/ Immunofluorescence: GCSH Antibody [NBP1-85842] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GCSH Antibody [NBP1-85842] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules..
Western Blot: GCSH Antibody [NBP1-85842] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GCSH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCSH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
GCSH Protein (NBP1-85842PEP)
Publications
Read Publication using
NBP1-85842 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GCSH Antibody

  • GCE
  • glycine cleavage system H protein, mitochondrial
  • glycine cleavage system protein H (aminomethyl carrier)
  • lipoic acid-containing protein
  • mitochondrial glycine cleavage system H-protein
  • NKH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83374
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
366-6C/CF
Species: Hu
Applications: BA
H00002729-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-15304
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF1107
Species: Mu
Applications: IHC, WB
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NBP2-46516
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00007357-M03
Species: Hu
Applications: ELISA, WB
NBP2-76932
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-47594
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84490
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
NBP1-85842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GCSH Antibody (NBP1-85842)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-85842 Applications Species
Liu L, Peng M, Shao Y et al. Mitochondrial FAD shortage in SLC25A32 deficiency affects folate-mediated one-carbon metabolism Research Square Mar 1 2022 (WB, Mouse) WB Mouse

Reviews for GCSH Antibody (NBP1-85842) (0)

There are no reviews for GCSH Antibody (NBP1-85842). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GCSH Antibody (NBP1-85842) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCSH Products

Bioinformatics Tool for GCSH Antibody (NBP1-85842)

Discover related pathways, diseases and genes to GCSH Antibody (NBP1-85842). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCSH Antibody (NBP1-85842)

Discover more about diseases related to GCSH Antibody (NBP1-85842).
 

Pathways for GCSH Antibody (NBP1-85842)

View related products by pathway.

PTMs for GCSH Antibody (NBP1-85842)

Learn more about PTMs related to GCSH Antibody (NBP1-85842).
 

Research Areas for GCSH Antibody (NBP1-85842)

Find related products by research area.

Blogs on GCSH

There are no specific blogs for GCSH, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCSH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCSH