GCSH Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GCSH Antibody [NBP1-85842] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GCSH Antibody [NBP1-85842] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules..

Western Blot: GCSH Antibody [NBP1-85842] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue

Lane 1: Mouse liver tissue lysateLane 2: Rat liver tissue lysate

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GCSH Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GCSH Antibody - BSA Free (NBP1-85842) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-GCSH Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GCSH
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100
  See Simple Western Antibody Database for Simple Western validation: Tested in Embryo, Muscle, separated by Size, antibody dilution of 1:50
• Control Peptide:

  GCSH Protein (NBP1-85842PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GCSH Antibody - BSA Free

• GCE
• glycine cleavage system H protein, mitochondrial
• glycine cleavage system protein H (aminomethyl carrier)
• lipoic acid-containing protein
• mitochondrial glycine cleavage system H-protein
• NKH

Background

The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to themitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase;MIM 238300), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme; MIM238310), and L protein (a lipoamide dehydrogenase; MIM 238331). Glycine encephalopathy (GCE; MIM 605899), also callednonketotic hyperglycinemia (NKH), may be due to a defect in any one of these enzymes.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GCSH Antibody (NBP1-85842)(1)

Publication using NBP1-85842

• Liu L, Peng M, Shao Y et al. Mitochondrial FAD shortage in SLC25A32 deficiency affects folate-mediated one-carbon metabolism Cell Mol Life Sci 2022-06-21 [PMID: 35727412]

Bioinformatics

• Gene Symbol: GCSH