GCSH Antibody

Images

 
Western Blot: GCSH Antibody [NBP1-85842] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunohistochemistry-Paraffin: GCSH Antibody [NBP1-85842] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules..
Western Blot: GCSH Antibody [NBP1-85842] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GCSH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCSH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GCSH Protein (NBP1-85842PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GCSH Antibody

  • GCE
  • glycine cleavage system H protein, mitochondrial
  • glycine cleavage system protein H (aminomethyl carrier)
  • lipoic acid-containing protein
  • mitochondrial glycine cleavage system H-protein
  • NKH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32907
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
366-6C/CF
Species: Hu
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007357-M03
Species: Hu
Applications: WB, ELISA
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84490
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-46231
Species: Hu
Applications: WB, IHC
NBP1-85842
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GCSH Antibody (NBP1-85842) (0)

There are no publications for GCSH Antibody (NBP1-85842).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCSH Antibody (NBP1-85842) (0)

There are no reviews for GCSH Antibody (NBP1-85842). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GCSH Antibody (NBP1-85842) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCSH Products

Bioinformatics Tool for GCSH Antibody (NBP1-85842)

Discover related pathways, diseases and genes to GCSH Antibody (NBP1-85842). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCSH Antibody (NBP1-85842)

Discover more about diseases related to GCSH Antibody (NBP1-85842).
 

Pathways for GCSH Antibody (NBP1-85842)

View related products by pathway.

PTMs for GCSH Antibody (NBP1-85842)

Learn more about PTMs related to GCSH Antibody (NBP1-85842).

Blogs on GCSH

There are no specific blogs for GCSH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCSH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCSH