GLDC Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Analysis in human placenta and skeletal muscle tissues. Corresponding GLDC RNA-seq data are presented for the same tissues.
Genetic Strategies: Western Blot: GLDC Antibody [NBP1-83374] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-GLDC antibody. Remaining relative ...read more
Orthogonal Strategies: Western Blot: GLDC Antibody [NBP1-83374] - Western blot analysis in human cell lines Caco-2 and HeLa. Corresponding GLDC RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Western Blot: GLDC Antibody [NBP1-83374] - Western blot analysis in mouse liver tissue and rat liver tissue.
Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human kidney shows moderate granular positivity in cytoplasm in cells in tubules.
Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human liver shows strong granular positivity in cytoplasm in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLDC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPENK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLDC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 25855294). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GLDC Protein (NBP1-83374PEP)
Publications
Read Publication using
NBP1-83374 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25855294).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLDC Antibody

  • EC 1.4.4.2
  • GCE
  • GCSPMGC138198
  • Glycine cleavage system P protein
  • glycine cleavage system protein P
  • glycine decarboxylase P-protein
  • Glycine decarboxylase
  • glycine dehydrogenase (decarboxylating)
  • glycine dehydrogenase (decarboxylating; glycine decarboxylase, glycine cleavagesystem protein P)
  • glycine dehydrogenase [decarboxylating], mitochondrial
  • HYGN1
  • MGC138200
  • NKH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004608-M01
Species: Bv, Hu, Mu, Po
Applications: DB, ELISA, S-ELISA, WB
NBP2-46516
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-85842
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
366-6C/CF
Species: Hu
Applications: BA
NBP1-85437
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80755
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-15304
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF1107
Species: Mu
Applications: IHC, WB
NBP1-91933
Species: Hu
Applications: IHC, IHC-P, WB
MAB1936
Species: Hu
Applications: IP, WB
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
664-LI/CF
Species: Hu
Applications: BA
H00004948-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-83374
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD

Publications for GLDC Antibody (NBP1-83374)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GLDC Antibody (NBP1-83374) (0)

There are no reviews for GLDC Antibody (NBP1-83374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLDC Antibody (NBP1-83374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLDC Products

Array NBP1-83374

Bioinformatics Tool for GLDC Antibody (NBP1-83374)

Discover related pathways, diseases and genes to GLDC Antibody (NBP1-83374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLDC Antibody (NBP1-83374)

Discover more about diseases related to GLDC Antibody (NBP1-83374).
 

Pathways for GLDC Antibody (NBP1-83374)

View related products by pathway.

PTMs for GLDC Antibody (NBP1-83374)

Learn more about PTMs related to GLDC Antibody (NBP1-83374).
 

Research Areas for GLDC Antibody (NBP1-83374)

Find related products by research area.

Blogs on GLDC

There are no specific blogs for GLDC, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLDC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLDC