GLDC Antibody - BSA Free

Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Analysis in human placenta and skeletal muscle tissues. Corresponding GLDC RNA-seq data are presented for the same tissues.

Western Blot: GLDC Antibody [NBP1-83374] - Western blot analysis in human cell lines Caco-2 and HeLa. Corresponding GLDC RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Western Blot: GLDC Antibody [NBP1-83374] - Western blot analysis in mouse liver tissue and rat liver tissue.

Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human kidney shows moderate granular positivity in cytoplasm in cells in tubules.

Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human liver shows strong granular positivity in cytoplasm in hepatocytes.

Analysis in Caco-2 cells) transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GLDC antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GLDC Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPENK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLDC
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 25855294). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GLDC Protein (NBP1-83374PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25855294).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GLDC Antibody - BSA Free

• EC 1.4.4.2
• GCE
• GCSPMGC138198
• Glycine cleavage system P protein
• glycine cleavage system protein P
• glycine decarboxylase P-protein
• Glycine decarboxylase
• glycine dehydrogenase (decarboxylating)
• glycine dehydrogenase (decarboxylating; glycine decarboxylase, glycine cleavagesystem protein P)
• glycine dehydrogenase [decarboxylating], mitochondrial
• HYGN1
• MGC138200
• NKH

Background

The enzyme system for cleavage of glycine (glycine cleavage system; GCS; EC 2.1.2.10), which is confined to themitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase),H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (alipoamide dehydrogenase). Glycine encephalopathy (GCE; MIM 605899) may be due to a defect in any one of these enzymes;see MIM 238310, MIM 238330, and MIM 238331.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GLDC Antibody (NBP1-83374)(1)

Publication using NBP1-83374

• Kim D, Fiske BP, Birsoy K et al. SHMT2 drives glioma cell survival in ischaemia but imposes a dependence on glycine clearance. Nature 2015-04-16 [PMID: 25855294] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: GLDC