GATE-16/GABARAPL2 Antibody - Azide and BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-50 of human GATE-16/GABARAPL2 (NP_009216.1). MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GABARAPL2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
| Theoretical MW |
13 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for GATE-16/GABARAPL2 Antibody - Azide and BSA Free
Background
GABARAPL2, also known as GATE-16, is involved in intra-Golgi traffic and belongs to the MAP1 LC3 family. GABARAPL2 modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. GABARAPL2 first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1. GABARAPL2 interacts with GABRG2, NSF, GOSR1 and beta-tubulin. The subcellular location of GABARAPL2 is the Golgi apparatus. GABARAPL2 is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle, and is expressed at very low levels in lung, thymus and small intestine.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
Species: Dr, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Al, Av, Ba, Bv, Ca, Ch, ChHa, SyHa, Gp, Ha, Hu, In, Pm, Mu, Po, Pm, Rb, Rt, Ze
Applications: ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, PAGE, Simple Western, WB
Species: Mu, Rt
Applications: IHC, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for GATE-16/GABARAPL2 Antibody (NBP3-03244) (0)
There are no publications for GATE-16/GABARAPL2 Antibody (NBP3-03244).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GATE-16/GABARAPL2 Antibody (NBP3-03244) (0)
There are no reviews for GATE-16/GABARAPL2 Antibody (NBP3-03244).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GATE-16/GABARAPL2 Antibody (NBP3-03244). (Showing 1 - 1 of 1 FAQ).
-
I am currently interested in detecting GABARAPL2 by immunofluorescence. Do you have an antibody that I could try out for immunofluorescence
- Here is the link using our search bar and filters
Secondary Antibodies
| |
Isotype Controls
|
Additional GATE-16/GABARAPL2 Products
Research Areas for GATE-16/GABARAPL2 Antibody (NBP3-03244)
Find related products by research area.
|
Blogs on GATE-16/GABARAPL2