Novus Biologicals products are now on bio-techne.com

GATE-16/GABARAPL2 Antibody

Images

 
Western Blot: GATE-16/GABARAPL2 Antibody [NBP1-88883] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: GATE-16/GABARAPL2 Antibody [NBP1-88883] - Staining of human cerebellum shows distinct cytoplasmic positivity in purkinje cells.
Western Blot: GATE-16/GABARAPL2 Antibody [NBP1-88883] - Analysis in human cerebral cortex tissue.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GATE-16/GABARAPL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKE
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GABARAPL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 1:100-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GATE-16/GABARAPL2 Protein (NBP1-88883PEP)
Publications
Read Publication using NBP1-88883.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GATE-16/GABARAPL2 Antibody

  • Apg8p2
  • ATG8
  • ATG8C
  • FLC3A
  • GABARAPL2
  • gamma-aminobutyric acid receptor-associated protein-like 2
  • Ganglioside expression factor 2
  • GATE16
  • GATE-16
  • GEF2
  • GEF-2
  • GEF2GEF-2
  • General Protein Transport Factor P16
  • Golgi-Associated ATPase Enhancer Of 16 KDa
  • MAP1 light chain 3 related protein
  • MAP1 light chain 3-related protein

Background

GABARAPL2, also known as GATE-16, is involved in intra-Golgi traffic and belongs to the MAP1 LC3 family. GABARAPL2 modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. GABARAPL2 first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1. GABARAPL2 interacts with GABRG2, NSF, GOSR1 and beta-tubulin. The subcellular location of GABARAPL2 is the Golgi apparatus. GABARAPL2 is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle, and is expressed at very low levels in lung, thymus and small intestine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
NBP1-71771
Species: Dr, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB6608
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP1-55202
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-15501
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NBP2-01083
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-24709
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-33950
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-41217
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-249
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-2220
Species: Al, Av, Ba, Bv, Ca, Ch, ChHa, SyHa, Gp, Ha, Hu, In, Pm, Mu, Po, Pm, Rb, Rt, Ze
Applications: ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, PAGE, Simple Western, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB

Publications for GATE-16/GABARAPL2 Antibody (NBP1-88883)(1)

Reviews for GATE-16/GABARAPL2 Antibody (NBP1-88883) (0)

There are no reviews for GATE-16/GABARAPL2 Antibody (NBP1-88883). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GATE-16/GABARAPL2 Antibody (NBP1-88883). (Showing 1 - 1 of 1 FAQ).

  1. I am currently interested in detecting GABARAPL2 by immunofluorescence. Do you have an antibody that I could try out for immunofluorescence
    • Here is the link using our search bar and filters

Secondary Antibodies

 

Isotype Controls

Additional GATE-16/GABARAPL2 Products

Research Areas for GATE-16/GABARAPL2 Antibody (NBP1-88883)

Find related products by research area.

Blogs on GATE-16/GABARAPL2

There are no specific blogs for GATE-16/GABARAPL2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GATE-16/GABARAPL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GABARAPL2