GATE-16/GABARAPL2 Antibody

Images

 
Western Blot: GABARAPL2 Antibody [NBP1-88883] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: GABARAPL2 Antibody [NBP1-88883] - Staining of human cerebellum shows distinct cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GATE-16/GABARAPL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GABARAPL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GATE-16/GABARAPL2 Protein (NBP1-88883PEP)
Publications
Read Publication using NBP1-88883.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GATE-16/GABARAPL2 Antibody

  • Apg8p2
  • ATG8
  • ATG8C
  • FLC3A
  • GABARAPL2
  • gamma-aminobutyric acid receptor-associated protein-like 2
  • Ganglioside expression factor 2
  • GATE16
  • GATE-16
  • GEF2
  • GEF-2
  • GEF2GEF-2
  • General Protein Transport Factor P16
  • Golgi-Associated ATPase Enhancer Of 16 KDa
  • MAP1 light chain 3 related protein
  • MAP1 light chain 3-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NBP1-71771
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15501
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-01083
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-24709
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NB100-2220
Species: Hu, Mu, Rt, Po, Ba, Bv, Ca, SyHa, Pm, Ze
Applications: WB, Simple Western, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KO
AF9024
Species: Mu, Rt
Applications: WB, IHC

Publications for GATE-16/GABARAPL2 Antibody (NBP1-88883)(1)

Reviews for GATE-16/GABARAPL2 Antibody (NBP1-88883) (0)

There are no reviews for GATE-16/GABARAPL2 Antibody (NBP1-88883). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GATE-16/GABARAPL2 Antibody (NBP1-88883). (Showing 1 - 1 of 1 FAQ).

  1. I am currently interested in detecting GABARAPL2 by immunofluorescence. Do you have an antibody that I could try out for immunofluorescence
    • Here is the link using our search bar and filters: http://www.novusbio.com/productsearch/GABARAPL2#fq=common_name%3A%22GABARAPL2%22&fq=applications%3A%22Immunofluorescence%22

Secondary Antibodies

 

Isotype Controls

Additional GATE-16/GABARAPL2 Products

Bioinformatics Tool for GATE-16/GABARAPL2 Antibody (NBP1-88883)

Discover related pathways, diseases and genes to GATE-16/GABARAPL2 Antibody (NBP1-88883). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATE-16/GABARAPL2 Antibody (NBP1-88883)

Discover more about diseases related to GATE-16/GABARAPL2 Antibody (NBP1-88883).
 

Pathways for GATE-16/GABARAPL2 Antibody (NBP1-88883)

View related products by pathway.

PTMs for GATE-16/GABARAPL2 Antibody (NBP1-88883)

Learn more about PTMs related to GATE-16/GABARAPL2 Antibody (NBP1-88883).

Blogs on GATE-16/GABARAPL2

There are no specific blogs for GATE-16/GABARAPL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GATE-16/GABARAPL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GABARAPL2
Entrez