GATA-6 Recombinant Protein Antigen

Images

 
There are currently no images for GATA-6 Recombinant Protein Antigen (NBP2-55937PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GATA-6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GATA-6.

Source: E. coli

Amino Acid Sequence: INKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GATA6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55937.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GATA-6 Recombinant Protein Antigen

  • GATA binding protein 6
  • GATA6
  • GATA-6
  • GATA-binding factor 6
  • GATA-binding protein 6
  • transcription factor GATA-6

Background

The Gata6 gene is a transcriptional activator that is crucial to modulating terminal differentiation and/or proliferation by regulating SEMA3C and PLXNA2. The Gata6 gene is most prominent during vertebrate development in early and later embryogenesis. Two isoforms exist: isoform 1 is 595 amino acids long at 60 kDa and isoform 2 exists at 449 amino acids in length and 45 kDA. The Gata6 gene focuses on endo- and mesodermally derived cells, thus participating significantly in gut, lung, and heart development and mutations of the Gata6 gene are linked to multiple congenital defects. The Gata6 gene has also been associated with polycystic ovary syndrome, hernias, teratoma, pulmonary fibrosis, germ cell tumor, gastric cancer, Crohn's disease, colorectal cancer, colon cancer, and carcinoma. It is known to interact with KLF13, MED1, HHEX, KLF2, and SP1 as it functions in pathways such as lymphocyte signaling, heart development, hemostasis, and thrombin signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24585
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF1700
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
NBP1-87991
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-24585
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF2170
Species: Hu
Applications: ChIP, ICC, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
AF1997
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
H00388112-B01P
Species: Hu
Applications: WB
NBP2-24583
Species: Bv, Eq, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC,  IHC-P
314-BP
Species: Hu
Applications: BA, BA
AF2444
Species: Hu
Applications: IHC, WB
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
7734-LF
Species: Hu
Applications: BA
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF2170
Species: Hu
Applications: ChIP, ICC, WB
NBP2-55937PEP
Species: Hu
Applications: AC

Publications for GATA-6 Recombinant Protein Antigen (NBP2-55937PEP) (0)

There are no publications for GATA-6 Recombinant Protein Antigen (NBP2-55937PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATA-6 Recombinant Protein Antigen (NBP2-55937PEP) (0)

There are no reviews for GATA-6 Recombinant Protein Antigen (NBP2-55937PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GATA-6 Recombinant Protein Antigen (NBP2-55937PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GATA-6 Products

Research Areas for GATA-6 Recombinant Protein Antigen (NBP2-55937PEP)

Find related products by research area.

Blogs on GATA-6

There are no specific blogs for GATA-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GATA-6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GATA6