Recombinant Human GATA-6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GATA-6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human GATA6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA

Protein/Peptide Type
Partial Recombinant Protein
Gene
GATA6

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM Na2PO4, pH 7.5

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GATA-6 Protein

  • GATA binding protein 6
  • GATA6
  • GATA-6
  • GATA-binding factor 6
  • GATA-binding protein 6
  • transcription factor GATA-6

Background

GATA6 - GATA binding protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1700
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2170
Species: Hu
Applications: WB, ChIP, ICC
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF1997
Species: Hu
Applications: WB, ChIP, ICC
H00388112-B01P
Species: Hu
Applications: WB, ELISA
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF2400
Species: Hu
Applications: WB, ChIP, ICC
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF2170
Species: Hu
Applications: WB, ChIP, ICC

Publications for GATA-6 Partial Recombinant Protein (H00002627-Q01) (0)

There are no publications for GATA-6 Partial Recombinant Protein (H00002627-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATA-6 Partial Recombinant Protein (H00002627-Q01) (0)

There are no reviews for GATA-6 Partial Recombinant Protein (H00002627-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GATA-6 Partial Recombinant Protein (H00002627-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GATA-6 Products

Bioinformatics Tool for GATA-6 Partial Recombinant Protein (H00002627-Q01)

Discover related pathways, diseases and genes to GATA-6 Partial Recombinant Protein (H00002627-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATA-6 Partial Recombinant Protein (H00002627-Q01)

Discover more about diseases related to GATA-6 Partial Recombinant Protein (H00002627-Q01).
 

Pathways for GATA-6 Partial Recombinant Protein (H00002627-Q01)

View related products by pathway.

PTMs for GATA-6 Partial Recombinant Protein (H00002627-Q01)

Learn more about PTMs related to GATA-6 Partial Recombinant Protein (H00002627-Q01).
 

Research Areas for GATA-6 Partial Recombinant Protein (H00002627-Q01)

Find related products by research area.

Blogs on GATA-6

There are no specific blogs for GATA-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GATA-6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GATA6
Entrez