GATA-2 Antibody - BSA Free

Western Blot: GATA-2 Antibody [NBP1-82581] - Microarray gene expression data. A number of genes were validated for gene expression changes by Western blot analysis. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/fulltext/1296), licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: GATA-2 Antibody [NBP1-82581] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581] - Staining of human placenta shows nuclear positivity in trophoblastic cells.

Western Blot: GATA-2 Antibody [NBP1-82581] - Analysis in human cell line SH-SY5Y.

Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581] - Staining of human kidney shows nuclear positivity in cells in tubules.

Simple Western: GATA-2 Antibody [NBP1-82581] - Simple Western lane view shows a specific band for GATA2 in 0.2 mg/mL of HELA lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: GATA-2 Antibody [NBP1-82581] - Electropherogram image(s) of corresponding Simple Western lane view. GATA-2 antibody was used at 1:100 dilution on HELA lysate(s).

Western Blot: GATA-2 Antibody [NBP1-82581] - Knock-down of GATA2 gene expression decreases proliferation, migration & matrigel invasion of prostate cancer cellsTreatment of LNCaP cells with siGATA2 leads to A, a marked reduction in GATA2 protein levels; & B, a marked decrease in cell proliferation. C, a monolayer of LNCaP cells was scratched to examine the rate of cell migration into the wounded area. The bar graph represents the percentage of cell-recovered wound areas after 8 hours of incubation (*, p<0.01). Representative images of the wound captured at different time points are shown (at right). D & E, cell migration & matrigel invasion assays show a marked decrease in cell motility & tissue invasiveness of siGATA2-treated LNCaP cells. Bar graphs show the percentage of migrated/invaded cells after a 20-hr incubation. Results (A-E) shown are representative of three individual experiments with error bars representing standard deviation based on triplicates. Statistical significance was established using the Student's t-test. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/24448395), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GATA-2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GATA2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID 24583263)
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Immunoprecipitation Validated from a verified customer review
  • Simple Western 1:100
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in HEL, separated by Size, antibody dilution of 1:100, apparent MW was 66 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  GATA-2 Protein (NBP1-82581PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24583263).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2), 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GATA-2 Antibody - BSA Free

• endothelial transcription factor GATA-2
• FLJ45948
• GATA binding protein 2
• GATA2
• GATA-2
• GATA-binding protein 2NFE1B
• MGC2306

Background

The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells (Tsai et al., 1994 [PubMed 8078582]). GATA1 (MIM 305371) is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells. In chicken erythroid progenitors, forced expression of GATA2 promotes proliferation at the expense of differentiation (Briegel et al., 1993 [PubMed 8504932]). GATA3 (MIM 131320) expression is restricted to T-lymphoid cells and some nonhematopoietic cell types, including embryonic stem cells.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GATA-2 Antibody (NBP1-82581)(9)

Publications using NBP1-82581

• Chiang YT. Identification of metastasis-driving genes as potential therapeutic targets/biomarkers for metastatic prostate cancer (Thesis Supervisor - Dr. Yuzhuo Wang, BC Cancer Agency Research Centre, Canada) Thesis 2015-01-01 (ICC/IF, WB, IHC-P, Human)
• Kazenwadel J, Venugopal P, Oszmiana A et al. A Prox1 enhancer represses haematopoiesis in the lymphatic vasculature Nature 2023-01-25 [PMID: 36697821] (IHC-WhMt, Mouse)
  
  Details:
  See extended data Fig. 7. Lots used C76352 and 000035473, Dilution used 1:500
• Yoji Kojima, Chika Yamashiro, Yusuke Murase, Yukihiro Yabuta, Ikuhiro Okamoto, Chizuru Iwatani et al. GATA transcription factors, SOX17 and TFAP2C, drive the human germ-cell specification program Life Science Alliance 2021-05-01 [PMID: 33608411]
• Yang Y, Cha B, Motawe ZY et al. VE-Cadherin Is Required for Lymphatic Valve Formation and Maintenance Cell Rep 2019-08-27 [PMID: 31461654]
• Buscheck F, Zub M, Heumann A et al. The independent prognostic impact of the GATA2 pioneering factor is restricted to ERG-negative prostate cancer Tumour Biol. 2019-07-01 [PMID: 31296150] (IF/IHC, Human)
• Pichol-Thievend C, Betterman KL, Liu X et al. A blood capillary plexus-derived population of progenitor cells contributes to genesis of the dermal lymphatic vasculature during embryonic development Development 2018-05-17 [PMID: 29773646] (Mouse)
• Frye M, Taddei A, Dierkes C et al. Matrix stiffness controls lymphatic vessel formation through regulation of a GATA2-dependent transcriptional program. Nat Commun 2018-04-17 [PMID: 29666442] (ICC/IF)
• Shi X, Richard J, Zirbes KM et al. Cooperative interaction of Etv2 and Gata2 regulates the development of endothelial and hematopoietic lineages. Dev. Biol. 2014-03-03 [PMID: 24583263] (IHC-Fr, Mouse)
• Chiang Yan Ting, Wang Kendric, Fazli Ladan et al. GATA2 as a potential metastasis-driving gene in prostate cancer. Oncotarget. 2014-01-30 [PMID: 24448395] (IF/IHC, Human)

Review for GATA-2 Antibody (NBP1-82581) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer IP Human 06/29/2020

Summary

• Application: Immunoprecipitation
• Sample Tested: Cancer cell lysates
• Species: Human
• Lot: N/A

Comments

• Comments: Antibody is great. I tried many different companies, none of them works.

Bioinformatics

• Gene Symbol: GATA2
• Entrez:
  • 2624(Human)
• Uniprot:
  • P23769()