Gastrokine 1 Antibody

Images

 
Immunohistochemistry-Paraffin: Gastrokine 1 Antibody [NBP2-14052] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Gastrokine 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLF QKKTCIVHKMNKEVMPSIQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GKN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Gastrokine 1 Protein (NBP2-14052PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Gastrokine 1 Antibody

  • 18 kDa antrum mucosa protein
  • AMP18
  • AMP-18
  • AMP18BRICHOS domain containing 1
  • BRICD1
  • CA11
  • CA11MGC70354
  • FOV
  • Foveolin
  • Gastrokine 1
  • gastrokine-1
  • GKN1
  • Protein CA11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31688
Species: Hu
Applications: IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31586
Species: Hu
Applications: IHC, IHC-P
NBP1-86654
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NB100-2564
Species: Hu
Applications: WB
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14052
Species: Hu
Applications: IHC, IHC-P

Publications for Gastrokine 1 Antibody (NBP2-14052) (0)

There are no publications for Gastrokine 1 Antibody (NBP2-14052).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gastrokine 1 Antibody (NBP2-14052) (0)

There are no reviews for Gastrokine 1 Antibody (NBP2-14052). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Gastrokine 1 Antibody (NBP2-14052) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Gastrokine 1 Products

Bioinformatics Tool for Gastrokine 1 Antibody (NBP2-14052)

Discover related pathways, diseases and genes to Gastrokine 1 Antibody (NBP2-14052). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gastrokine 1 Antibody (NBP2-14052)

Discover more about diseases related to Gastrokine 1 Antibody (NBP2-14052).
 

Pathways for Gastrokine 1 Antibody (NBP2-14052)

View related products by pathway.

PTMs for Gastrokine 1 Antibody (NBP2-14052)

Learn more about PTMs related to Gastrokine 1 Antibody (NBP2-14052).
 

Research Areas for Gastrokine 1 Antibody (NBP2-14052)

Find related products by research area.

Blogs on Gastrokine 1

There are no specific blogs for Gastrokine 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gastrokine 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GKN1
Entrez