Gastrokine 1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Gastrokine 1 Antibody - BSA Free (NBP2-14052) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: NDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GKN1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Gastrokine 1 Antibody - BSA Free
Background
GKN1, also known as Gastrokine-1, is a 199 amino acid that is approx. 22 kDa, found to be expressed in stomach; has been shown to have mitogenic activity and may be influencing gastric mucosal epithelium. Studies on this protein have shown a relationship with the following diseases and disorders: patent ductus arteriosus, congenital diaphragmatic hernia, respiratory failure, pulmonary hypertension, hernia, gastric cancer, hypertension, gastritis colorectal cancer, and adenocarcinoma. This protein has been linked to positive regulation of cell proliferation, positive regulation of cell division, and digestion pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for Gastrokine 1 Antibody (NBP2-14052) (0)
There are no publications for Gastrokine 1 Antibody (NBP2-14052).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Gastrokine 1 Antibody (NBP2-14052) (0)
There are no reviews for Gastrokine 1 Antibody (NBP2-14052).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Gastrokine 1 Antibody (NBP2-14052) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Gastrokine 1 Products
Research Areas for Gastrokine 1 Antibody (NBP2-14052)
Find related products by research area.
|
Blogs on Gastrokine 1