Carbonic Anhydrase X/CA10 Antibody

Images

 
Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of pancreas.
Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells and moderate cytoplasmic nuclear in cells in molecular layer.
Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of pancreas.
Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of liver cancer.
Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells and moderate cytoplasmic nuclear in cells in molecular layer.
Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of liver cancer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carbonic Anhydrase X/CA10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CA10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Carbonic Anhydrase X/CA10 Protein (NBP2-31586PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Carbonic Anhydrase X/CA10 Antibody

  • CA10
  • Carbonic Anhydrase X
  • carbonic anhydrase-related protein 10
  • Carbonic anhydrase-related protein X
  • CARP X
  • CARPX
  • CA-RPX
  • CARPXCA-RP X
  • Cerebral protein 15
  • cerebral protein-15
  • HUCEP-15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000770-T02
Species: Hu
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88871
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2593
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP1-86654
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF7287
Species: Hu, Mu
Applications: WB, IHC
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00006690-M01
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31586
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Carbonic Anhydrase X/CA10 Antibody (NBP2-31586) (0)

There are no publications for Carbonic Anhydrase X/CA10 Antibody (NBP2-31586).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase X/CA10 Antibody (NBP2-31586) (0)

There are no reviews for Carbonic Anhydrase X/CA10 Antibody (NBP2-31586). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Carbonic Anhydrase X/CA10 Antibody (NBP2-31586) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carbonic Anhydrase X/CA10 Products

Bioinformatics Tool for Carbonic Anhydrase X/CA10 Antibody (NBP2-31586)

Discover related pathways, diseases and genes to Carbonic Anhydrase X/CA10 Antibody (NBP2-31586). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase X/CA10 Antibody (NBP2-31586)

Discover more about diseases related to Carbonic Anhydrase X/CA10 Antibody (NBP2-31586).
 

Pathways for Carbonic Anhydrase X/CA10 Antibody (NBP2-31586)

View related products by pathway.

PTMs for Carbonic Anhydrase X/CA10 Antibody (NBP2-31586)

Learn more about PTMs related to Carbonic Anhydrase X/CA10 Antibody (NBP2-31586).

Blogs on Carbonic Anhydrase X/CA10

There are no specific blogs for Carbonic Anhydrase X/CA10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase X/CA10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CA10
Entrez
Uniprot