Gastrokine 2 Antibody


Immunohistochemistry-Paraffin: Gastrokine 2 Antibody [NBP2-31688] - Staining of human stomach shows high expression.
Immunohistochemistry: Gastrokine 2 Antibody [NBP2-31688] - Staining of stomach cancer.
Immunohistochemistry-Paraffin: Gastrokine 2 Antibody [NBP2-31688] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Gastrokine 2 Antibody [NBP2-31688] - Staining in human stomach and pancreas tissues using anti-GKN2 antibody. Corresponding GKN2 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Gastrokine 2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PPLNNLQWYIYEKQALDNMFSSKYTWVKYNPLESLIKDVDWFLLGSPIEKLCKHIPLYKGEVVENT
Specificity of human, human (negative) Gastrokine 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Gastrokine 2 Protein (NBP2-31688PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Gastrokine 2 Antibody

  • BlblDown-regulated in gastric cancer
  • BLOT
  • down regulated in gastric cancer GDDR
  • gastrokine 2
  • GDDRdown-regulated in gastric cancer GDDR
  • PRO813
  • TFIZ1gastrokine-2
  • Trefoil factor interactions(z) 1
  • VLTI465


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB
Species: Hu

Publications for Gastrokine 2 Antibody (NBP2-31688) (0)

There are no publications for Gastrokine 2 Antibody (NBP2-31688).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gastrokine 2 Antibody (NBP2-31688) (0)

There are no reviews for Gastrokine 2 Antibody (NBP2-31688). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Gastrokine 2 Antibody (NBP2-31688) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Gastrokine 2 Products

Bioinformatics Tool for Gastrokine 2 Antibody (NBP2-31688)

Discover related pathways, diseases and genes to Gastrokine 2 Antibody (NBP2-31688). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gastrokine 2 Antibody (NBP2-31688)

Discover more about diseases related to Gastrokine 2 Antibody (NBP2-31688).

Pathways for Gastrokine 2 Antibody (NBP2-31688)

View related products by pathway.

PTMs for Gastrokine 2 Antibody (NBP2-31688)

Learn more about PTMs related to Gastrokine 2 Antibody (NBP2-31688).

Blogs on Gastrokine 2

There are no specific blogs for Gastrokine 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Gastrokine 2 Antibody and receive a gift card or discount.


Gene Symbol GKN2