GAPDH-2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GAPDH-2 Antibody [NBP2-31925] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry: GAPDH-2 Antibody [NBP2-31925] - Staining of human testis shows strong cytoplasmic positivity in spermatids.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GAPDH-2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVIS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAPDHS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GAPDH-2 Protein (NBP2-31925PEP)
Publications
Read Publication using NBP2-31925.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GAPDH-2 Antibody

  • EC 1.2.1
  • EC 1.2.1.12
  • GAPD2
  • GAPD2HSD-35
  • GAPDH2
  • GAPDH-2
  • GAPDH-2glyceraldehyde-3-phosphate dehydrogenase, testis-specific
  • GAPDHS
  • GAPDS
  • glyceraldehyde-3-phosphate dehydrogenase, spermatogenic
  • HSD-35
  • Spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2
  • Spermatogenic glyceraldehyde-3-phosphate dehydrogenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31452
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-48336
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-89165
Species: Hu
Applications: IHC, IHC-P

Publications for GAPDH-2 Antibody (NBP2-31925)(1)

Reviews for GAPDH-2 Antibody (NBP2-31925) (0)

There are no reviews for GAPDH-2 Antibody (NBP2-31925). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GAPDH-2 Antibody (NBP2-31925) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAPDH-2 Products

Bioinformatics Tool for GAPDH-2 Antibody (NBP2-31925)

Discover related pathways, diseases and genes to GAPDH-2 Antibody (NBP2-31925). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAPDH-2 Antibody (NBP2-31925)

Discover more about diseases related to GAPDH-2 Antibody (NBP2-31925).
 

Pathways for GAPDH-2 Antibody (NBP2-31925)

View related products by pathway.

PTMs for GAPDH-2 Antibody (NBP2-31925)

Learn more about PTMs related to GAPDH-2 Antibody (NBP2-31925).

Blogs on GAPDH-2

There are no specific blogs for GAPDH-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAPDH-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAPDHS
Entrez
Uniprot