GAPDH-2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GAPDH-2 Antibody [NBP2-31925] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: GAPDH-2 Antibody [NBP2-31925] - Staining in human testis and kidney tissues using anti-GAPDHS antibody. Corresponding GAPDHS RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GAPDH-2 Antibody [NBP2-31925] - Staining of human kidney shows low expression as expected.

Immunohistochemistry-Paraffin: GAPDH-2 Antibody [NBP2-31925] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GAPDH-2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GAPDH-2 Antibody - BSA Free (NBP2-31925) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-GAPDH-2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This GAPDH-2 antibody was developed against a recombinant protein corresponding to amino acids: KYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVIS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GAPDHS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GAPDH-2 Protein (NBP2-31925PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GAPDH-2 Antibody - BSA Free

• EC 1.2.1
• EC 1.2.1.12
• GAPD2
• GAPD2HSD-35
• GAPDH2
• GAPDH-2
• GAPDH-2glyceraldehyde-3-phosphate dehydrogenase, testis-specific
• GAPDHS
• GAPDS
• glyceraldehyde-3-phosphate dehydrogenase, spermatogenic
• HSD-35
• Spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2
• Spermatogenic glyceraldehyde-3-phosphate dehydrogenase

Background

GAPDHS encodes a protein belonging to the glyceraldehyde-3-phosphate dehydrogenase family of enzymes that play an important role in carbohydrate metabolism. Like its somatic cell counterpart, this sperm-specific enzyme functions in a nicotinamide adenine dinucleotide-dependent manner to remove hydrogen and add phosphate to glyceraldehyde 3-phosphate to form 1,3-diphosphoglycerate. During spermiogenesis, this enzyme may play an important role in regulating the switch between different energy-producing pathways, and it is required for sperm motility and male fertility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GAPDH-2 Antibody (NBP2-31925)(1)

Publication using NBP2-31925

• Djureinovic D, Fagerberg L, Hallstrom B et al. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Mol Hum Reprod 2014-06-01 [PMID: 24598113]

Bioinformatics

• Gene Symbol: GAPDHS
• Uniprot:
  • O14556(Human)