Home » AKAP4 » AKAP4 Antibodies » AKAP4 Antibody

AKAP4 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human colon.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human colon.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining in human testis and endometrium tissues using anti-AKAP4 antibody. Corresponding AKAP4 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human colon, kidney, liver and testis using Anti-AKAP4 antibody NBP1-89165 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human kidney.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

AKAP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SALKLIQYHLTQQTKGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKAP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AKAP4 Protein (NBP1-89165PEP)
Publications
Read Publication using NBP1-89165.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AKAP4 Antibody

  • A kinase (PRKA) anchor protein 4
  • AKAP-4
  • AKAP82AKAP 82
  • A-kinase anchor protein 4
  • A-kinase anchor protein 82 kDa
  • cancer/testis antigen 99
  • CT99
  • hAKAP82Fsc1
  • HIFSC1
  • Major sperm fibrous sheath protein
  • p82
  • PRKA4
  • protein kinase A anchoring protein 4
  • Protein kinase A-anchoring protein 4
  • testis-specific gene HI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Bim Antibody - BSA
Free
NBP1-76963
Immunocytochemistry/Immunofluorescence: Bim Antibody [NBP1-76963] - K562 cells with at 20 ug/mL.
Western Blot: Bim Antibody [NBP1-76963] - Western Blot Validation in Rat Myeloma Cell line:Loading: 15 ug of rat myeloma YB2/0 cell lysate per lane.Antibodies: BIM NBP1-76963, (0.5 ug/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate.
Western Blot: Bim Antibody [NBP1-76963] - Western Blot Validation in HeLa Cells. Loading: 15 ug of lysate per lane. Antibodies: Bim NBP1-76963, (0.5 ug/mL), 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate. Bim antibody can detect all three human isoforms, including EL, L and S isoforms.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
SMC3 Antibody
NB100-207
SMC3 Antibody [NB100-207] - Detection of human SMC3 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa, cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-SMC3 antibody NB100-207(lot NB100-207-9) used for IP at 3 ug per reaction. SMC3 was also immunoprecipitated by a previous lot of this antibody (lot NB100-207-8). For blotting immunoprecipitated SMC3, NB100-207 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Western Blot: SMC3 Antibody [NB100-207] - Whole cell lysate (10 ug) from HEK293T, HeLa, Jurkat, LNCaP, U2OS, A-549, TCMK-1, and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinitypurified rabbit anti-SMC3 antibody used for WB at 0.04 ug/ml. Detection:Chemiluminescence with an exposure time of 3 seconds.
Immunohistochemistry-Paraffin: SMC3 Antibody [NB100-207] - Section of human breast carcinoma. Antibody: Affinity purified rabbit anti-SMC3 used at 1:5,000 (0.2ug/ml). Detection: DAB
(9 Publications)
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(15 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase‑3 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Rabbit Anti-Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Caspase‑3 was detected in immersion fixed Jurkat human acute T cell leukemia cell line stimulated with staurosporin using Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (yellow; Catalog # NL004) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(7 Reviews)
(198 Publications)
Species: Hu, Mu
Applications: ICC, IHC
Transglutaminase
1/TGM1 Antibody
NBP2-34062
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human esophagus shows high expression.
Western Blot: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human tonsil tissue.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human colon shows no positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB

Acetylcholinesterase/A
NB100-1519
Flow Cytometry: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (1ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Western Blot: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Staining (0.3ug/ml) of Jurkat (A) and (0.5ug/ml) HepG2 (B) cell lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml), showing nuclear, membrane and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml).
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(732 Publications)
Species: Hu
Applications: BA
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-Page: Recombinant Human PRH2 Protein [H00005555-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
CXADR Antibody
NBP1-88192
Immunocytochemistry/Immunofluorescence: CXADR Antibody [NBP1-88192] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human skeletal muscle shows low expression as expected.
Western Blot: CXADR Antibody [NBP1-88192] - Analysis in human cell lines Caco-2 and MCF-7. Corresponding CXADR RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Connexin 26/GJB2
Antibody - BSA Free
NBP2-41304
Western Blot: Connexin 26/GJB2 Antibody [NBP2-41304] - Analysis of Connexin 26/GJB2 in human colon tissue lysate with Connexin 26/GJB2 antibody at (A) 1 and (B) 2 ug/ml.
Immunocytochemistry/Immunofluorescence: Connexin 26/GJB2 Antibody [NBP2-41304] - Cx26 distribution at level of the cardiomyocyte cytoplasm. Confocal laser scanning microscopy: representative images of rat and pig heart sections. Double immunofluorescence analysis for Cx26 (red) and Cx43 (green) show a distinct cell localization of the two Cxs. (a) Three dimensional picture of the maximum intensity projection of the raw images of longitudinal rat heart section treated with R(alpha)Cx26-cl and M(alpha)Cx43. Scale bar: 20um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-32405-2), licensed under a CC-BY licence.
Immunohistochemistry: Connexin 26/GJB2 Antibody [NBP2-41304] - Positive and negative tissue controls for Cx26. Representative images of immunohistochemical analysis for Cx26 on rat liver and skeletal muscle sections by R(alpha)Cx26-cl antibody. Cx26 positive brown punctate staining of hepatocyte plasma membrane (arrows) and cytoplasm (arrowheads) is shown in liver. By contrast, Cx26 staining is absent in skeletal muscle. Negative controls are showen in the squares. Scale bars: 50um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-32405-2), licensed under a CC-BY licence.
(3 Publications)
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Cytosolic
Sulfotransferase 1A1/ ...
NBP2-03227
Flow Cytometry: SULT1A1 Antibody (9B7) [NBP2-03227] - Analysis of Jurkat cells, using anti-SULT1A1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: SULT1A1 Antibody (9B7) [NBP2-03227] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-SULT1A1 antibody, and then analyzed by flow cytometry.
Western Blot: SULT1A1 Antibody (9B7) [NBP2-03227] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SULT1A1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SULT1A1.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ST8
alpha-2,8-Sialyltrans ...
7027-GT
ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 [Unconjugated]
Species: Hu
Applications: EnzAct
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Progesterone R/NR3C3 was detected in immersion fixed T47D human breast cancer cell line using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 1.7 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Progesterone R/NR3C3 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of T47D human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) followed by HRP‑conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for PR-A and PR-B at approximately 90 and 118 kDa, respectively (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(4 Reviews)
(345 Publications)
Species: Hu
Applications: BA
MBP Antibody (12)
NB600-717
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse spinal cord ventral white matter. Image from verified customer review.
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse brain corpus callosum. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: MBP Antibody (12) [NB600-717] - Histological and mRNA analysis of the inflammatory cytokines in the vehicle- or etifoxine-treated mice at onset of clinical symptoms. At day 10 p.i., drug treated animals showed significant differences in MBP staining. Animals treated with etifoxine showed an increase in retention of percentage of MBP coverage (*p = 0.001). Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/cgi/doi/10.1002/emmm.201202124), licensed under a CC-BY licence.
(3 Reviews)
(27 Publications)
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB

Publications for AKAP4 Antibody (NBP1-89165)(1)


Reviews for AKAP4 Antibody (NBP1-89165) (0)

There are no reviews for AKAP4 Antibody (NBP1-89165). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AKAP4 Antibody (NBP1-89165) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKAP4 Products

Array NBP1-89165

Bioinformatics Tool for AKAP4 Antibody (NBP1-89165)

Discover related pathways, diseases and genes to AKAP4 Antibody (NBP1-89165). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP4 Antibody (NBP1-89165)

Discover more about diseases related to AKAP4 Antibody (NBP1-89165).
 

Pathways for AKAP4 Antibody (NBP1-89165)

View related products by pathway.

PTMs for AKAP4 Antibody (NBP1-89165)

Learn more about PTMs related to AKAP4 Antibody (NBP1-89165).
 

Research Areas for AKAP4 Antibody (NBP1-89165)

Find related products by research area.

Blogs on AKAP4

There are no specific blogs for AKAP4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKAP4 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AKAP4