AKAP4 Antibody

Images

 
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human colon.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining in human testis and endometrium tissues using anti-AKAP4 antibody. Corresponding AKAP4 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human colon, kidney, liver and testis using Anti-AKAP4 antibody NBP1-89165 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human kidney.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AKAP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SALKLIQYHLTQQTKGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKAP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AKAP4 Protein (NBP1-89165PEP)
Publications
Read Publication using NBP1-89165.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AKAP4 Antibody

  • A kinase (PRKA) anchor protein 4
  • AKAP-4
  • AKAP82AKAP 82
  • A-kinase anchor protein 4
  • A-kinase anchor protein 82 kDa
  • cancer/testis antigen 99
  • CT99
  • hAKAP82Fsc1
  • HIFSC1
  • Major sperm fibrous sheath protein
  • p82
  • PRKA4
  • protein kinase A anchoring protein 4
  • Protein kinase A-anchoring protein 4
  • testis-specific gene HI

Background

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is localized to the sperm flagellum and may be involved in the regulation of sperm motility. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AKAP4 Antibody (NBP1-89165)(1)

Reviews for AKAP4 Antibody (NBP1-89165) (0)

There are no reviews for AKAP4 Antibody (NBP1-89165). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AKAP4 Antibody (NBP1-89165) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKAP4 Products

Array NBP1-89165

Research Areas for AKAP4 Antibody (NBP1-89165)

Find related products by research area.

Blogs on AKAP4

There are no specific blogs for AKAP4, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKAP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP4