Home » AKAP4 » AKAP4 Antibodies » AKAP4 Antibody

AKAP4 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human colon.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human colon.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining in human testis and endometrium tissues using anti-AKAP4 antibody. Corresponding AKAP4 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human colon, kidney, liver and testis using Anti-AKAP4 antibody NBP1-89165 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human kidney.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

AKAP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SALKLIQYHLTQQTKGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQ
Specificity
Specificity of human AKAP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKAP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-89165.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AKAP4 Antibody

  • A kinase (PRKA) anchor protein 4
  • AKAP-4
  • AKAP82AKAP 82
  • A-kinase anchor protein 4
  • A-kinase anchor protein 82 kDa
  • cancer/testis antigen 99
  • CT99
  • hAKAP82Fsc1
  • HIFSC1
  • Major sperm fibrous sheath protein
  • p82
  • PRKA4
  • protein kinase A anchoring protein 4
  • Protein kinase A-anchoring protein 4
  • testis-specific gene HI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Bim Antibody
NBP1-76963
Western Blot: Bim Antibody [NBP1-76963] - Independent Antibody Validation (IAV) via Protein Expression Profile in Cell LinesLoading: 15 ug of lysates per lane.Antibodies: BIM NBP1-76963, (0.5 ug/mL), BIM NBP1-77118, (5 ug/mL), beta-actin (1 ug/mL) and GAPDH (0.02 ug/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
Immunohistochemistry-Paraffin: Bim Antibody [NBP1-76963] - Human skin cancer cells with Bim antibody at 20 ug/ml.
Western Blot: Bim Antibody [NBP1-76963] - Western Blot Validation in Rat Myeloma Cell line:Loading: 15 ug of rat myeloma YB2/0 cell lysate per lane.Antibodies: BIM NBP1-76963, (0.5 ug/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate.
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, IHC, IHC-P, IF
SMC3 Antibody
NB100-207
Western Blot: SMC3 Antibody [NB100-207] - Whole cell lysate (10 ug) from HEK293T, HeLa, Jurkat, LNCaP, U2OS, A-549, TCMK-1, and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinitypurified rabbit anti-SMC3 antibody used for WB at 0.04 ug/ml. Detection:Chemiluminescence with an exposure time of 3 seconds.
Immunohistochemistry-Paraffin: SMC3 Antibody [NB100-207] - Section of mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-SMC3 used at 1:5,000 (0.2ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: SMC3 Antibody [NB100-207] - Section of human breast carcinoma. Antibody: Affinity purified rabbit anti-SMC3 used at 1:5,000 (0.2ug/ml). Detection: DAB
(8 Publications)
Species: Hu, Mu, Ce
Applications: WB, IHC, IHC-P, IP
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Insulin E2E3, human pancreas (FFPE), HIER pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Image of Caspase-3 Antibody (31A1067) - (Pro and Active). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Immunohistochemistry-Paraffin: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Tissue section of human spleen using 1:200 dilution of Caspase-3 antibody (clone 31A1067). The staining was developed with HRP labeled anti-mouse IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This Caspase 3 antibody generated primarily a specific cytoplasmic staining in a subset of spleenocytes with some nuclear signal in a few cells.
Simple Western: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Simple Western lane view shows a specific band for Caspase-3 Antibody (31A1067) - (Pro and Active) in 0.1 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system.
(1 Review)
(145 Publications)
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KO
Transglutaminase
1/TGM1 Antibody
NBP2-34062
Western Blot: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human tonsil tissue.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human colon shows no positivity in glandular cells.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human esophagus shows high expression.
Species: Hu
Applications: WB, IHC, IHC-P

Acetylcholinesterase/A
NBP1-31329
Western Blot: Acetylcholinesterase/ACHE Antibody [NBP1-31329] - Various tissue extracts (50 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with AChE antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Acetylcholinesterase/ACHE Antibody [NBP1-31329] - Paraformaldehyde-fixed HeLa, using AChE antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with an alpha Tubulin antibody (Red) at 1:2500.
Immunohistochemistry-Frozen: Acetylcholinesterase/ACHE Antibody [NBP1-31329] - Frozen sectioned E13.5 Rat brain. Green: AChE protein stained by AChE antibody diluted at 1:250. Red: beta Tubulin 3/ TUJ1, a mature neuron marker, stained by beta Tubulin 3/ TUJ1 antibody [11710] (NBP2-43559) diluted at 1:500. Blue: Fluoroshield with DAPI.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NDUFB6 Antibody
NBP1-92172
Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(28 Reviews)
(635 Publications)
Species: Hu
Recombinant Human
PRH2 Protein
H00005555-P01
SDS-Page: Recombinant Human PRH2 Protein [H00005555-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Septin-4 Antibody
NBP1-90093
Immunocytochemistry/Immunofluorescence: Septin-4 Antibody [NBP1-90093] - Staining of human cell line Hep G2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Septin-4 Antibody [NBP1-90093] - Staining of human cerebellum shows strong cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: Septin-4 Antibody [NBP1-90093] - Analysis in human cerebral cortex and pancreas tissues. Corresponding SEPT4 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CXADR Antibody
NBP1-88192
Western Blot: CXADR Antibody [NBP1-88192] - Analysis in human cell lines Caco-2 and MCF-7. Corresponding CXADR RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: CXADR Antibody [NBP1-88192] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining in human rectum and skeletal muscle tissues using anti-CXADR antibody. Corresponding CXADR RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Connexin 26/GJB2
Antibody
NB100-57840
Western Blot: Connexin 26/GJB2 Antibody [NB100-57840] - Staining of Mouse Brain lysate with antibody at 0.01 ug/mL (A), Mouse Heart (B) and Rat Heart (C) lysate with antibody at 0.5 ug/mL (35 ug protein in RIPA buffer). Detected by chemiluminescence.
Flow Cytometry: Connexin 26/GJB2 Antibody [NB100-57840] - Flow cytometric analysis of paraformaldehyde fixed HepG2 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Western Blot: Connexin 26/GJB2 Antibody [NB100-57840] - Staining of Human Colon (A), Heart (B), Prostate (C), Skin (D) and negative control Adipose (E) lysate (35 ug protein in RIPA buffer). Antibody at 1 ug/mL. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Flow, PEP-ELISA
Cytosolic
Sulfotransferase 1A1/ ...
NBP2-03227
Western Blot: SULT1A1 Antibody (9B7) [NBP2-03227] Analysis of extracts (35ug) from 9 different cell lines by using anti-SULT1A1 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: SULT1A1 Antibody (9B7) [NBP2-03227] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY SULT1A1.
Immunohistochemistry-Paraffin: SULT1A1 Antibody (9B7) [NBP2-03227] - Staining of paraffin-embedded Human prostate tissue using anti-SULT1A1 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
ST8
alpha-2,8-Sialyltrans ...
NBP2-20497
Western Blot: ST8SIA4 Antibody [NBP2-20497] - Sample (30 ug of whole cell lysate) A: Jurkat B: Raji C: THP-1 D: NCI-H929 10% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: ST8SIA4 Antibody [NBP2-20497] - Immunohistochemical analysis of paraffin-embedded U373 xenograft, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
Progesterone
R/NR3C3 Antibody (Alp ...
NB120-2765
Immunohistochemistry-Paraffin: Progesterone R/NR3C3 Antibody (Alpha PR6) [NB120-2765] - Staining of human uterus tissue.
(1 Publication)
Species: Hu, Mu, Rt, Bv, Ch, Gp, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(18 Reviews)
(293 Publications)
Species: Hu
MBP Antibody (12)
NB600-717
Western Blot: MBP Antibody (12) [NB600-717] - Mouse Brain Tissue lysate probed with Rat anti MBP.
Immunocytochemistry/Immunofluorescence: MBP Antibody (12) [NB600-717] - Histological and mRNA analysis of the inflammatory cytokines in the vehicle- or etifoxine-treated mice at onset of clinical symptoms. At day 10 p.i., drug treated animals showed significant differences in MBP staining. Animals treated with etifoxine showed an increase in retention of percentage of MBP coverage (*p = 0.001). Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/cgi/doi/10.1002/emmm.201202124), licensed under a CC-BY licence.
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse brain corpus callosum. Image from verified customer review.
(3 Reviews)
(16 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ch, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
AKAP4 Antibody
NBP1-89165
AKAP4 Antibody
Species: Hu
Applications: IHC, IHC-P

Publications for AKAP4 Antibody (NBP1-89165)(1)


Reviews for AKAP4 Antibody (NBP1-89165) (0)

There are no reviews for AKAP4 Antibody (NBP1-89165). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AKAP4 Antibody (NBP1-89165) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional AKAP4 Products

Array NBP1-89165

Bioinformatics Tool for AKAP4 Antibody (NBP1-89165)

Discover related pathways, diseases and genes to AKAP4 Antibody (NBP1-89165). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP4 Antibody (NBP1-89165)

Discover more about diseases related to AKAP4 Antibody (NBP1-89165).
 

Pathways for AKAP4 Antibody (NBP1-89165)

View related products by pathway.

PTMs for AKAP4 Antibody (NBP1-89165)

Learn more about PTMs related to AKAP4 Antibody (NBP1-89165).

Blogs on AKAP4

There are no specific blogs for AKAP4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKAP4 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AKAP4
COVID-19 update