gamma C Crystallin Antibody

Images

 
Western Blot: gamma C Crystallin Antibody [NBP1-52908] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

gamma C Crystallin Antibody Summary

Immunogen
Synthetic peptides corresponding to CRYGC(crystallin, gamma C) The peptide sequence was selected from the middle region of CRYGC. Peptide sequence GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRYGC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CRYGC and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for gamma C Crystallin Antibody

  • CCL
  • CRYG3gamma-C-crystallin
  • crystallin, gamma C
  • crystallin, gamma-3
  • Gamma-C-crystallin
  • Gamma-crystallin 2-1
  • Gamma-crystallin 3
  • gamma-crystallin C

Background

Crystallins are the dominant structural components of the vertebrate eye lens.Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

31310002
Species: Hu
Applications: WB, ELISA
366-6C/CF
Species: Hu
NBP2-46354
Species: Hu
Applications: WB, IHC, IF
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
MAB5695
Species: Hu, Mu
Applications: WB
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52908
Species: Hu
Applications: WB

Publications for gamma C Crystallin Antibody (NBP1-52908) (0)

There are no publications for gamma C Crystallin Antibody (NBP1-52908).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for gamma C Crystallin Antibody (NBP1-52908) (0)

There are no reviews for gamma C Crystallin Antibody (NBP1-52908). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for gamma C Crystallin Antibody (NBP1-52908) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional gamma C Crystallin Products

Bioinformatics Tool for gamma C Crystallin Antibody (NBP1-52908)

Discover related pathways, diseases and genes to gamma C Crystallin Antibody (NBP1-52908). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gamma C Crystallin Antibody (NBP1-52908)

Discover more about diseases related to gamma C Crystallin Antibody (NBP1-52908).
 

Pathways for gamma C Crystallin Antibody (NBP1-52908)

View related products by pathway.

Research Areas for gamma C Crystallin Antibody (NBP1-52908)

Find related products by research area.

Blogs on gamma C Crystallin

There are no specific blogs for gamma C Crystallin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our gamma C Crystallin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRYGC
Uniprot