Home » Galectin-9 » Galectin-9 Proteins » Galectin-9 Recombinant Protein Antigen

Galectin-9 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Galectin-9 Protein (NBP2-33484PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Galectin-9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LGALS9.

Source: E.coli

Amino Acid Sequence: RFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTIN
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LGALS9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-33484.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Galectin-9 Recombinant Protein Antigen

  • Ecalectin
  • GAL9
  • gal-9
  • galectin 9
  • Galectin9
  • Galectin-9
  • HUAT
  • lectin, galactoside-binding, soluble, 9
  • LGALS9
  • LGALS9A
  • MGC117375
  • MGC125973
  • MGC125974
  • Tumor antigen HOM-HD-21
  • urate transporter/channel protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TIM-3 Antibody
[Unconjugated]
AF2365
TIM‑3 was detected in immersion fixed paraffin-embedded sections of human tonsil using Goat Anti-Human TIM‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2365) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes and extracellular space. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
TIM-3 mRNA was detected in formalin-fixed paraffin-embedded tissue sections of human tonsil probed with ACD RNAScope® Probe (Catalog # 560681) and stained using ACD RNAscope® 2.5 HD Detection Reagents-Red (top image, Catalog # 32260). Adjacent tissue section was processed for immunohistochemistry using R&D Systems Goat Anti-Human TIM-3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2365) at 3 ug/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte HRP Polymer Antibody (R&D Systems, Catalog # VC004) and DAB chromogen (lower image, yellow-brown). Tissues were counterstained with hematoxylin (blue).
(3 Reviews)
(15 Publications)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Dual ISH-IHC
Galectin-1
Antibody [Unconjugate
AF1152
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and A549 human lung carcinoma cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Galectin‑1 at approximately 14 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Human peripheral blood monocytes were stained with Mouse Anti-Human CD14 PE-conjugated Monoclonal Antibody (Catalog # FAB3832P) and either (A) Normal Goat IgG Control (Catalog # AB-108-C) or (B) Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and A549 human lung carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Galectin‑1 at approximately 17 kDa (as indicated) using 1 µg/mL of Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(4 Reviews)
(10 Publications)
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
(8 Reviews)
(29 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Galectin-8
Antibody [Unconjugate
AF1305
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Galectin‑8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1305) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Galectin‑8 at approximately 35 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of LNCaP human prostate cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for Galectin‑8 at approximately 40 kDa (as indicated) using 10 µg/mL of Goat Anti-Human Galectin‑8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1305) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Galectin‑8 was detected in immersion fixed paraffin-embedded sections of human lung using Goat Anti-Human Galectin‑8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1305) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit  (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(6 Reviews)
(10 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
IL-10 [Biotin]
DY417
(6 Reviews)
(186 Publications)
Species: Mu
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma.
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(19 Reviews)
(333 Publications)
Species: Hu
IL-4 [Unconjugated]
6507-IL/CF
IL-4 [Unconjugated]
(3 Publications)
Species: Hu
CD8 Antibody
(53-6.7)
NBP1-49045
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of immersion fixed splenocytes. Primary antibody was used at a dilution of 10 ug/mL and incubated for 3 hours at room temperature.
Immunohistochemistry: CD8 Antibody (53-6.7) [NBP1-49045] - Histopathological analysis of spinal cord in EAE mice. Representative spinal cord sections from wild-type (WT), Asic1-/-, and Asic2-/- mice at 45 days after immunization. Sections of the spinal cord anterior horn were stained with hematoxylin and eosin (E&H) to assess inflammation and immunostained for MCHII, CD4+, CD8+ infiltrating cells. Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1111/ejn.14302), licensed under a CC-BY licence.
Flow Cytometry: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.
(2 Reviews)
(16 Publications)
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Galectin-3
Antibody [Unconjugate
AF1197
Western blot shows lysates of MCF‑7 human breast cancer cell line, U‑118‑MG human glioblastoma/astrocytoma cell line, C6 rat glioma cell line, and NR8383 rat alveolar macrophage cell line. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Mouse Galectin‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1197) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Galectin‑3 at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Galectin‑3 was detected in immersion fixed frozen sections of mouse embryo (15 d.p.c., cross-section through the eye) using Goat Anti-Human Galectin‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1197 ) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of HT‑2 mouse T cell line and Balb/3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for Galectin‑3 at approximately 44 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse Galectin‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1197) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
(2 Reviews)
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
FoxP3 Antibody
NB100-39002
Immunohistochemistry-Paraffin: FoxP3 Antibody [NB100-39002] - Mouse spleen stained with FoxP3 antibody. IHC-P image submitted by a verified customer review.
Immunohistochemistry-Paraffin: FoxP3 Antibody [NB100-39002] - Tissue section of human tonsil using 1:200 dilution of rabbit anti-FoxP3 antibody. The staining was developed with HRP-labeled anti-rabbit IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This FoxP3 antibody generated an expected and a specific nuclear staining of FOXP3 in a subset of cells which are potentially the Treg cells.
Immunohistochemistry: FoxP3 Antibody [NB100-39002] - Antibody was tested in mouse spleen using DAB with hematoxylin counterstain.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(22 Reviews)
(302 Publications)
Species: Hu
TIM-1/KIM-1/HAVCR
Antibody
NBP1-76701
Western Blot: TIM-1/KIM-1/HAVCR Antibody [NBP1-76701] - HeLa cells were transfected with control siRNAs (lane 1) or TIM-1 siRNAs (lane 2) Loading: 15 ug of HeLa whole cell lysates per lane. Antibodies: 3809 (8 ug/mL), 1 hincubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
Immunocytochemistry/Immunofluorescence: TIM-1/KIM-1/HAVCR Antibody [NBP1-76701] - in Human Uterus cells. Dilution 20 ug/mL.
Immunohistochemistry-Paraffin: TIM-1/KIM-1/HAVCR Antibody [NBP1-76701] - Analysis of human uterus tissue using anti-TIM-1 antibody (3809) at 10 ug/ml.Tissue was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4 C. A goat anti-rabbit IgG H&L (HRP)at 1/250 was used as secondary. Counter stained with Hematoxylin.
(14 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
CRX/CORD2 Antibody
(4G11)
H00001406-M02
Western Blot: CRX/CORD2 Antibody (4G11) [H00001406-M02] - Analysis of CRX expression in transfected 293T cell line by CRX monoclonal antibody (M02), clone 4G11.Lane 1: CRX transfected lysate(32 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: CRX/CORD2 Antibody (4G11) [H00001406-M02] - Retinal development is recapitulated in differentiating stem cells. Immunostaining of day 49 cultures shows remnants of retinal organization. CRX+ photoreceptor progenitors in green and mCherry+ RGCs in magenta. CRX+ cells - white arrows - appear to segregate from mCherry+ axons, suggesting division between the outer nuclear layer and the nerve fiber layer. Scale bar?=?500?um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep16595), licensed under a CC-BY licence.
Western Blot: CRX/CORD2 Antibody (4G11) [H00001406-M02] - CRX monoclonal antibody (M02), clone 4G11 Analysis of CRX expression in IMR-32.
(19 Publications)
Species: Hu, Mu, Bv, Fi
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA
RPGR Antibody
NBP1-84412
Immunohistochemistry-Paraffin: RPGR Antibody [NBP1-84412] - Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: RPGR Antibody [NBP1-84412] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: RPGR Antibody [NBP1-84412] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
IL-5 [HRP]
M5000
(3 Reviews)
(71 Publications)
Species: Mu
CCL11/Eotaxin [HRP]
MME00
(1 Review)
(50 Publications)
Species: Mu
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(645 Publications)
Species: Hu
IL-6 [HRP]
D6050
(25 Reviews)
(463 Publications)
Species: Hu
Doublecortin
Antibody (3E1)
NBP1-92684
Western Blot: Doublecortin Antibody (3E1) [NBP1-92684] - Analysis of rat whole brain lysates using mouse mAb to Doublecortin (DCX), NBP1-92684, dilution 1:1,000 in green: [1] protein standard (red), [2] adult rat brain, [3] embryonic E20 rat brain. Strong bands at 40, 45kDa correspond to DCX protein, detected only in the developing brain.
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody (3E1) [NBP1-92684] - Analysis of cortical neuron-glial cell culture from E20 rat stained with mouse mAb to Doublecortin (DCX), NBP1-92684, dilution 1:1,000 in red, and costained with chicken pAb to Microtubule Associated Protein2 (MAP2), dilution 1:10,000 in green. The blue is DAPI staining of nuclear DNA. DCX antibody reveals strong cytoplasmic staining in a population of small developing neurons and their processes, while MAP2 antibody stains dendrites and perikarya of mature neurons. Therefore DCX antibody is an excellent marker of developing neuronal cells.
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody (3E1) [NBP1-92684] - Rat brain neural cultures stained with NBP1-92684 (green), a chicken polyclonal antibody to GFAP (NB300-213, red) and DNA (blue). The NBP1-92684 antibody reveals strong cytoplasmic staining in a population of small developing neurons. These cells are often found in small clumps as in these cultures, as in this example. Note that they are not positive for MAP2, which is characteristic of more mature neurons, and that the mature neuron shown is negative for NBP1-92684. This Doublecortin antibody is therefore an excellent marker of developing neuronal cells.
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Galectin-9
Recombinant Protein A
NBP2-33484PEP
Galectin-9 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Galectin-9 Protein (NBP2-33484PEP) (0)

There are no publications for Galectin-9 Protein (NBP2-33484PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galectin-9 Protein (NBP2-33484PEP) (0)

There are no reviews for Galectin-9 Protein (NBP2-33484PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Galectin-9 Protein (NBP2-33484PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional Galectin-9 Products

Bioinformatics Tool for Galectin-9 Protein (NBP2-33484PEP)

Discover related pathways, diseases and genes to Galectin-9 Protein (NBP2-33484PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Galectin-9 Protein (NBP2-33484PEP)

Discover more about diseases related to Galectin-9 Protein (NBP2-33484PEP).
 

Pathways for Galectin-9 Protein (NBP2-33484PEP)

View related products by pathway.

PTMs for Galectin-9 Protein (NBP2-33484PEP)

Learn more about PTMs related to Galectin-9 Protein (NBP2-33484PEP).
 

Research Areas for Galectin-9 Protein (NBP2-33484PEP)

Find related products by research area.

Blogs on Galectin-9

There are no specific blogs for Galectin-9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Galectin‑9 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) treated with Calcium Ionomycin and PMA using Goat Anti-Human Galectin‑9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2045) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Galectin-9 Antibody [Unconjugated]
AF2045

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Galectin-9 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LGALS9