Galectin-12 Antibody - BSA Free

Western Blot: Galectin-12 Antibody [NBP3-10172] - Western blot analysis of Galectin-12 in Mouse Kidney lysates. Antibody dilution at 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Galectin-12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Galectin-12 Antibody - BSA Free (NBP3-10172) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Galectin-12 (NP_062389.1). Peptide sequence HYRYRLPLSRVDTLDISGDILVKAVGFLNINPFVEGSREYPVGYPFLLYS
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LGALS12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Galectin-12 Antibody - BSA Free

• GAL12
• Gal-12
• galectin 12
• Galectin-12
• Galectin-related inhibitor of proliferation
• GRIP1
• GRIP1galectin-12
• lectin, galactoside-binding, soluble, 12
• LGALS12

Background

LGALS12, also known as Galectin-12, is a protein with 6 isoforms ranging from 266 amino acid and 30 kDa to 366 amino acid and 38 kDa; predominantly expressed in adipose tissue; binds lactose and may play role in the apoptosis of adipocytes. There is no current information about this protein involvement in any disease or disorder. It has been shown that LGALS12 protein participates in apoptotic process and induction of apoptosis by intracellular signals pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LGALS12