Galectin-12 Antibody

Images

 
Western Blot: Galectin-12 Antibody [NBP3-10172] - Western blot analysis of Galectin-12 in Mouse Kidney lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Galectin-12 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse Galectin-12 (NP_062389.1). Peptide sequence HYRYRLPLSRVDTLDISGDILVKAVGFLNINPFVEGSREYPVGYPFLLYS
Clonality
Polyclonal
Host
Rabbit
Gene
LGALS12
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for Galectin-12 Antibody

  • GAL12
  • Gal-12
  • galectin 12
  • Galectin-12
  • Galectin-related inhibitor of proliferation
  • GRIP1
  • GRIP1galectin-12
  • lectin, galactoside-binding, soluble, 12
  • LGALS12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-314
Species: Hu
Applications: IP, WB
NB200-310
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NB100-61050
Species: Hu
Applications: IHC, IHC-P, IP, PLA, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-331
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-89765
Species: Hu
Applications: IHC, IHC-P
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NB100-41403
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NB300-124
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-76932
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-10172
Species: Mu
Applications: WB

Publications for Galectin-12 Antibody (NBP3-10172) (0)

There are no publications for Galectin-12 Antibody (NBP3-10172).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galectin-12 Antibody (NBP3-10172) (0)

There are no reviews for Galectin-12 Antibody (NBP3-10172). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Galectin-12 Antibody (NBP3-10172) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Galectin-12 Products

Bioinformatics Tool for Galectin-12 Antibody (NBP3-10172)

Discover related pathways, diseases and genes to Galectin-12 Antibody (NBP3-10172). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Galectin-12 Antibody (NBP3-10172)

Discover more about diseases related to Galectin-12 Antibody (NBP3-10172).
 

Pathways for Galectin-12 Antibody (NBP3-10172)

View related products by pathway.

PTMs for Galectin-12 Antibody (NBP3-10172)

Learn more about PTMs related to Galectin-12 Antibody (NBP3-10172).

Blogs on Galectin-12

There are no specific blogs for Galectin-12, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Galectin-12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LGALS12