G9a/EHMT2 Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human G9a/EHMT2 (NP_006700). Peptide sequence VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
EHMT2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Chromatin Immunoprecipitation (ChIP)
- Western Blot 1.0 ug/ml
|
Theoretical MW |
132 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for G9a/EHMT2 Antibody - BSA Free
Background
G9A antibody contains ankyrin repeats, suggesting involvement in intracellular protein-protein interaction. G9A is a histone methyltransferase that preferentially methylates Lys-9 of histone H3 and Lys-27 of histone H3 (in vitro). H3 Lys-9 methylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. G9A is probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow-IC, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: ChIP, ELISA, IHC, IHC-P, KD, Simple Western, WB
Publications for G9a/EHMT2 Antibody (NBP3-10942) (0)
There are no publications for G9a/EHMT2 Antibody (NBP3-10942).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for G9a/EHMT2 Antibody (NBP3-10942) (0)
There are no reviews for G9a/EHMT2 Antibody (NBP3-10942).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for G9a/EHMT2 Antibody (NBP3-10942) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional G9a/EHMT2 Products
Research Areas for G9a/EHMT2 Antibody (NBP3-10942)
Find related products by research area.
|
Blogs on G9a/EHMT2