Histamine N-Methyltransferase/HNMT Antibody

Images

 
Western Blot: Histamine N-Methyltransferase/HNMT Antibody [NBP1-89495] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Histamine N-Methyltransferase/HNMT Antibody [NBP1-89495] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Histamine N-Methyltransferase/HNMT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNMT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Histamine N-Methyltransferase/HNMT Protein (NBP1-89495PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Histamine N-Methyltransferase/HNMT Antibody

  • EC 2.1.1.8
  • Histamine NMethyltransferase
  • Histamine N-Methyltransferase
  • HMT
  • HNMT
  • HNMT-S1
  • HNMT-S2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84304
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16800
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-00688
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP2-43801
Species: Hu
Applications: WB
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
MAB4726
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59580
Species: Hu, Rt
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP1-89495
Species: Hu, Mu, Rt, Rt
Applications: WB, IHC, IHC-P

Publications for Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495) (0)

There are no publications for Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495) (0)

There are no reviews for Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Histamine N-Methyltransferase/HNMT Products

Bioinformatics Tool for Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495)

Discover related pathways, diseases and genes to Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495)

Discover more about diseases related to Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495).
 

Pathways for Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495)

View related products by pathway.

PTMs for Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495)

Learn more about PTMs related to Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495).

Blogs on Histamine N-Methyltransferase/HNMT

There are no specific blogs for Histamine N-Methyltransferase/HNMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histamine N-Methyltransferase/HNMT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNMT
Entrez