Histamine N-Methyltransferase/HNMT Antibody

Images

 
Western Blot: Histamine N-Methyltransferase/HNMT Antibody [NBP1-89495] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: Histamine N-Methyltransferase/HNMT Antibody [NBP1-89495] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Histamine N-Methyltransferase/HNMT Antibody [NBP1-89495] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Histamine N-Methyltransferase/HNMT Antibody [NBP1-89495] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Histamine N-Methyltransferase/HNMT Antibody [NBP1-89495] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Histamine N-Methyltransferase/HNMT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNMT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Histamine N-Methyltransferase/HNMT Protein (NBP1-89495PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Histamine N-Methyltransferase/HNMT Antibody

  • EC 2.1.1.8
  • Histamine NMethyltransferase
  • Histamine N-Methyltransferase
  • HMT
  • HNMT
  • HNMT-S1
  • HNMT-S2

Background

In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495) (0)

There are no publications for Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495) (0)

There are no reviews for Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Histamine N-Methyltransferase/HNMT Antibody (NBP1-89495) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histamine N-Methyltransferase/HNMT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNMT